DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP001395

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_321740.5 Gene:AgaP_AGAP001395 / 1281782 VectorBaseID:AGAP001395 Length:268 Species:Anopheles gambiae


Alignment Length:276 Identity:94/276 - (34%)
Similarity:127/276 - (46%) Gaps:45/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVPDG----RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTV 93
            |||.|    |||||..::..|:.|..||..:|        .|.||.||.|:..::||.|||...|
Mosquito     2 SVPCGSQQQRIVGGVNSNRGQITYIASLTKRG--------GHFCGASIVNDRWLLTAGHCVCSGV 58

  Fly    94 -----ASQYKVVAG----TNF---QTGSD-----GVITNVKEIVMHEGYYSGAAYNNDIAILFVD 141
                 |:|.:.|.|    :.|   |..||     .....::.||.|.||..... :||||:|.:.
Mosquito    59 NKILRANQIQAVLGLYRRSEFGGNQIDSDPFSDRAYEVGIRTIVPHPGYVCNKP-SNDIALLELA 122

  Fly   142 PPLPLNNFTIKAIKLALEQ------PIEGTVSKVSGWGTTSPG---GYSSNQLLAVDVPIVSNEL 197
            ..:   :|:.....:.|..      .:||..:.|:|||.....   |..::.|....|.:..||.
Mosquito   123 RRI---DFSASVRPICLSSGADGSARVEGQTAVVAGWGWQQENRNLGDKADTLQRAVVDVFRNEE 184

  Fly   198 CDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE-LYGVVSWGNSCALPNYPG 261
            |:..|.. |:.:..|....||||| |.||.|||..||||||...|. |.|:||.|..||.|.:||
Mosquito   185 CESMYRR-GNRSRTIARTQLCAGK-GTGGVDACWADSGGPLVTSDNVLIGIVSTGIGCARPGFPG 247

  Fly   262 VYANVAYLRPWIDAVL 277
            :|..|:....||..|:
Mosquito   248 IYTRVSEYASWIVTVI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 87/261 (33%)
Tryp_SPc 39..276 CDD:238113 88/263 (33%)
AgaP_AGAP001395XP_321740.5 Tryp_SPc 11..259 CDD:214473 87/261 (33%)
Tryp_SPc 12..259 CDD:238113 86/260 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.