DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zetaTry and AgaP_AGAP005691

DIOPT Version :9

Sequence 1:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_315702.4 Gene:AgaP_AGAP005691 / 1276364 VectorBaseID:AGAP005691 Length:301 Species:Anopheles gambiae


Alignment Length:261 Identity:81/261 - (31%)
Similarity:117/261 - (44%) Gaps:45/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVI---GTVASQYKV 99
            ||..|......|.|:||:|..:..|:     ...|||||....||:||||||:   .|:||....
Mosquito    55 RITNGQEATPGQFPHQIALLSEYATS-----TGLCGGSILTRNTILTAAHCVVSGPSTLASGGVA 114

  Fly   100 VAGT---NFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQP 161
            :.|.   |.|..:...|......:.....|:.|:..||||.:.::.|:   .||.:.      ||
Mosquito   115 IMGAHNRNVQESTQQRIRFATSGIRVHPQYNLASIRNDIATVRLNSPM---TFTTRI------QP 170

  Fly   162 IE-----------GTVSKVSGWGTTSPGGYSSNQLLAVDV-PIVSNELCDQDYEDFGDETYRITS 214
            |.           |....|||:|.||....:::.::.... |:::|..|...:     .|..:.:
Mosquito   171 IRLPGRSDTRQFGGFTGTVSGFGRTSDASTATSAVVRFTTNPVMTNADCVARW-----GTTMVQN 230

  Fly   215 AMLCAGKRGVGGADACQGDSGGPLAVRDE---LYGVVSW--GNSCALPNYPGVYANVAYLRPWID 274
            ..:|..  |.||..||.|||||.|.|:..   ..||||:  .|.||: ..|.|||.|::..|||:
Mosquito   231 QNVCLS--GAGGRSACNGDSGGALTVQSGGTLQIGVVSFVSVNGCAV-GMPSVYARVSFFLPWIE 292

  Fly   275 A 275
            |
Mosquito   293 A 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 78/257 (30%)
Tryp_SPc 39..276 CDD:238113 80/260 (31%)
AgaP_AGAP005691XP_315702.4 Tryp_SPc 55..291 CDD:214473 78/257 (30%)
Tryp_SPc 56..294 CDD:238113 80/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.