DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and Cpr65Au

DIOPT Version :8

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001286953.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster

Alignment Length:96 Identity:33/96 - (34%)
Similarity:50/96 - (52%) Gaps:8/96 - (8%)


  Fly    10 LAVMVACG--QALPVDPEREPVAI-LKSEIIKTEEGYTSAYVGADGISRNEEAFLVDKGTDEE-- 69
            |...:|.|  .|.|...:.:...| |:||  .|.:.|:.||..::||||.|.. .|..|..||  
  Fly     8 LVAFLAIGICLAFPAGEDAQAETIKLESE--NTGDKYSFAYETSNGISRTETG-EVKPGAGEEDG 69

  Fly    70 ALEVKGSYKYINEDGQEVEVFYTAGKNGFVP 100
            :|.|:||..:...||::.|:.:||.:.|:.|
  Fly    70 SLSVQGSTSWSAPDGKKYEISFTADETGYHP 100

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:278791 21/56 (38%)
Cpr65AuNP_001286953.1 Chitin_bind_4 42..98 CDD:278791 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.