DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and Cpr49Af

DIOPT Version :8

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001286347.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster

Alignment Length:108 Identity:27/108 - (25%)
Similarity:47/108 - (43%) Gaps:6/108 - (5%)


  Fly     7 LFVLAVMVACGQALPVDPEREPVAILKSEIIKTEEGYTSAYVGADGISRNEEAFLVDKGTDEEAL 71
            |.::|:.|....|...|   :|::  :...::....|...|...||....::..|.....|....
  Fly     4 LMLIALFVVAASATDND---DPIS--QESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNGE 63

  Fly    72 EVKGSYKYINEDGQEVEVFYTAGKNGFVPYGS-IINPEITAVA 113
            .|.|.|.::.:||:...|.|||.:||::..|. :..|..|.|:
  Fly    64 SVNGKYSFVADDGKTYVVSYTADENGYLAVGDHLPTPPPTPVS 106

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:278791 16/54 (30%)
Cpr49AfNP_001286347.1 Chitin_bind_4 35..90 CDD:278791 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.