DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and CG15756

DIOPT Version :8

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster

Alignment Length:95 Identity:24/96 (25%)
Similarity:36/96 (38%) Gaps:16/96 (17%)


  Fly    19 ALPVDPEREPVAILKSEIIKTEEG---------------YTSAYVGADGISRNEEAFLVDKGTDE 68
            |.|..|:.:|..::..:...||..               |...|...:|.:|.|.|:.:..|.| 
  Fly    69 APPPQPQPQPPVVVVQKPSHTETSPRLVDSFDQRSLDGQYEFRYQLDNGNTRYERAYWLPVGKD- 132

  Fly    69 EALEVKGSYKYINEDGQEVEVFYTAGKNGF 98
            ..|..||.|.....:.:...|||||...|:
  Fly   133 LVLAKKGYYSVPLPNDKYSTVFYTADHRGY 162

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:278791 18/55 (33%)
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791 18/55 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.