DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and Cpr65Av

DIOPT Version :10

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster


Alignment Length:102 Identity:37/102 - (36%)
Similarity:58/102 - (56%) Gaps:11/102 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAVMVACGQAL-------PVDPEREPVAILK--SEIIKTEEGYTSAYVGADGISRNEEAFLVDKG 65
            :.|:..|..||       |:| :.:...||:  ::.|.| :||...|..:||::|.|:|.:.:.|
  Fly     6 ICVLAICAFALLSTIRAAPLD-DSQHATILRYDNDNIGT-DGYNFGYETSDGVTRQEQAEVKNAG 68

  Fly    66 TDEEALEVKGSYKYINEDGQEVEVFYTAGKNGFVPYG 102
            ||:|||.|:||..::..|||...:.|.|.:|||.|.|
  Fly    69 TDQEALSVRGSVSWVAPDGQTYTLHYIADENGFQPQG 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 22/54 (41%)
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 22/54 (41%)

Return to query results.
Submit another query.