DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Syx7 and PEP12

Sequence 1:NP_730632.1 Gene:Syx7 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_014679.1 Gene:PEP12 SGDID:S000005562 Length:288 Species:Saccharomyces cerevisiae

Alignment Length:291 Identity:67/292 (23%)
Similarity:125/292 (43%) Gaps:65/292 (22%)


  Fly    22 DFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELK-KQLHQI-------MTYTNQLVTDT 78
            :||.|.:.:|..:.::...:||:|:....|.:..|..::. |.:.:|       :.....|:...
Yeast    25 EFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDRGDVSAKVVERINKRSVAKIEEIGGLIKKV 89

  Fly    79 NNQINEVDKCKERHLK----IQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQA---------- 129
            |..:.::|..:|..|.    |.|::||.:.:.:...||.:||:...:.|....:|          
Yeast    90 NTSVKKMDAIEEASLDKTQIIAREKLVRDVSYSFQEFQGIQRQFTQVMKQVNERAKESLEASEMA 154

  Fly   130 ----------RGDSYNIARPPGS----SRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQME 180
                      |.:|....|.|||    .|...:|...:.|.|                       
Yeast   155 NDAALLDEEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQN----------------------- 196

  Fly   181 EQADLQALEEQEQVIRELENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLR 245
                  .:|:::|.|..:|..|..:||::|.||::|.:||:.||:||:.:..||......::.||
Yeast   197 ------LIEQRDQEISNIERGITELNEVFKDLGSVVQQQGVLVDNIEANIYTTSDNTQLASDELR 255

  Fly   246 KASSYRNKVRKKKLILVGILSAVLLAIILIL 276
            ||..|:.:..:.::.|:.:|..:||.|.||:
Yeast   256 KAMRYQKRTSRWRVYLLIVLLVMLLFIFLIM 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 22/108 (20%)
COG5325 <97..276 CDD:227635 50/203 (25%)
SNARE 188..247 CDD:304603 22/59 (37%)
PEP12NP_014679.1 COG5325 4..288 CDD:227635 67/292 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5325
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I1578
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000767
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128082
Panther 1 1.100 O PTHR19957
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3589
TreeFam 1 0.960
109.860

Return to query results.
Submit another query.