DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Syx7 and VAM3

Sequence 1:NP_730632.1 Gene:Syx7 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_568671.1 Gene:VAM3 AraportID:AT5G46860 Length:268 Species:Arabidopsis thaliana

Alignment Length:299 Identity:85/300 (28%)
Similarity:138/300 (46%) Gaps:56/300 (19%)


  Fly     1 MDLQHMENG-------LSGGGGGGLSEIDFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSP 58
            |..|.:|:|       .:||.         |...|.:|:.|.::...|||.||:||.|.||:|:|
plant     1 MSFQDLESGRGRSTRKFNGGR---------QDSTQAVASGIFQINTGVSTFQRLVNTLGTPKDTP 56

  Fly    59 ELKKQLHQIMTYTNQLVTDTNNQINEVDKCKER-----HLKIQRDRLVDEFTAALTAFQSVQRKT 118
            ||:::||:...:..|||.||:.::.|..:...:     ..||...:|..:|.|.|..||..|:..
plant    57 ELREKLHKTRLHIGQLVKDTSAKLKEASETDHQSGVNPSKKIADAKLARDFQAVLKEFQKAQQTA 121

  Fly   119 ADIEKTALRQARGDSYNIARPPGSSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQMEEQA 183
            |:.|.|         |....|..:.   .|:.:|.:.|            |..:|:.|.|..::.
plant   122 AERETT---------YTPFVPQSAL---PSSYTAGEVD------------KVPEQRAQLQESKRQ 162

  Fly   184 DL-----------QALEEQEQVIRELENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFV 237
            :|           ..:||:||.|:|:...|..||||:|.|..||.:||:.:|.|.:.::.:....
plant   163 ELVLLDNEIAFNEAVIEEREQGIQEIHQQIGEVNEIFKDLAVLVNDQGVMIDDIGTHIDNSRAAT 227

  Fly   238 SQGTENLRKASSYRNKVRKKKLILVGILSAVLLAIILIL 276
            |||...|.:|:..:........:|:.|...|||.:|::|
plant   228 SQGKSQLVQAAKTQKSNSSLTCLLLVIFGIVLLIVIIVL 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 36/101 (36%)
COG5325 <97..276 CDD:227635 50/190 (26%)
SNARE 188..247 CDD:304603 23/59 (39%)
VAM3NP_568671.1 Syntaxin_2 28..128 CDD:291208 36/109 (33%)
SNARE_Qa 178..236 CDD:277193 23/58 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H37823
Inparanoid 1 1.050 109 1.000 Inparanoid score I2020
OMA 1 1.010
OrthoDB 1 1.010 D1204812at2759
OrthoInspector 1 1.000 T32337
orthoMCL 1 0.900 OOG5_128082
Panther 1 1.100 LDO PTHR19957
Phylome 1 0.910 0.600 Consistency score
98.980

Return to query results.
Submit another query.