DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Syx7 and SYP21

Sequence 1:NP_730632.1 Gene:Syx7 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_197185.1 Gene:SYP21 AraportID:AT5G16830 Length:279 Species:Arabidopsis thaliana

Alignment Length:267 Identity:73/268 (27%)
Similarity:128/268 (48%) Gaps:37/268 (14%)


  Fly    27 AQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDTNNQINEVDKCKER 91
            :|.:|..|.::...|::..|:||.:.||:|:.||:.:|.:.....::||.:|:.::.|..:. :.
plant    33 SQEVAAGIFRISTAVNSFFRLVNSIGTPKDTLELRDKLQKTRLQISELVKNTSAKLKEASEA-DL 96

  Fly    92 H------LKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIARPPGSSRTGSSNS 150
            |      .||...:|..:|.:.|..||..||..|:.|             |...|..::...::.
plant    97 HGSASQIKKIADAKLAKDFQSVLKEFQKAQRLAAERE-------------ITYTPVVTKEIPTSY 148

  Fly   151 SASQQDNNSFFEDNFFNRKSNQQQ--MQTQMEEQADLQ--------ALEEQEQVIRELENNIVGV 205
            :|.:.|..|.       |.|.||.  :|::.:|...|.        .:||:||.|||:|:.|..|
plant   149 NAPELDTESL-------RISQQQALLLQSRRQEVVFLDNEITFNEAIIEEREQGIREIEDQIRDV 206

  Fly   206 NEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILVGILSAVLL 270
            |.::|.|..:|..||..||.|.|.::.:....:|.|..||||:..:........:|:.|...|||
plant   207 NGMFKDLALMVNHQGNIVDDISSNLDNSHAATTQATVQLRKAAKTQRSNSSLTCLLILIFGIVLL 271

  Fly   271 AIILILV 277
            .:|::::
plant   272 IVIIVVL 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 28/102 (27%)
COG5325 <97..276 CDD:227635 53/189 (28%)
SNARE 188..247 CDD:304603 25/59 (42%)
SYP21NP_197185.1 SynN 27..164 CDD:238105 37/152 (24%)
Syntaxin 49..221 CDD:279182 52/193 (27%)
SNARE_Qa 189..247 CDD:277193 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I2020
OMA 1 1.010
OrthoDB 1 1.010 D1204812at2759
OrthoInspector 1 1.000 T32337
orthoMCL 1 0.900 OOG5_128082
Panther 1 1.100 O PTHR19957
Phylome 1 0.910 0.600 Consistency score
87.980

Return to query results.
Submit another query.