DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Syx7 and SYP23

Sequence 1:NP_730632.1 Gene:Syx7 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001078403.1 Gene:SYP23 AraportID:AT4G17730 Length:262 Species:Arabidopsis thaliana

Alignment Length:272 Identity:78/273 (29%)
Similarity:134/273 (49%) Gaps:37/273 (14%)


  Fly     1 MDLQHMENG----------LSGGGGGGLSEIDFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQ 55
            |..|.:|.|          ::|||..       |...|.:|:.|.::..:|||..|:||.|.||:
plant     1 MSFQDLEAGRGRSLASSRNINGGGSR-------QDTTQDVASGIFQINTSVSTFHRLVNTLGTPK 58

  Fly    56 DSPELKKQLHQIMTYTNQLVTDTNNQINEVDKCKERHLKIQRDRLVD-----EFTAALTAFQSVQ 115
            |:|||:::||:...|..|||.||:.::.|..:...:....|:.::||     :|.|.|..||..|
plant    59 DTPELREKLHKTRLYIGQLVKDTSAKLKEASETDHQRGVNQKKKIVDAKLAKDFQAVLKEFQKAQ 123

  Fly   116 RKTADIEKTALRQARGDSYN--IARPPGSSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQ 178
            |..|:.|..         |.  :.:|   |...|..||....:.:...|......:|.:|::...
plant   124 RLAAERETV---------YAPLVHKP---SLPSSYTSSEIDVNGDKHPEQRALLVESKRQELVLL 176

  Fly   179 MEEQADLQA-LEEQEQVIRELENNIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTE 242
            ..|.|..:| :||:||.|:|::..|..|:||:|.|..||::||..:|.|.:.::.:....:||..
plant   177 DNEIAFNEAVIEEREQGIQEIQQQIGEVHEIFKDLAVLVHDQGNMIDDIGTHIDNSYAATAQGKS 241

  Fly   243 NLRKASSYRNKV 254
            :|.:...:::::
plant   242 HLVRHQRHKDQI 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 36/101 (36%)
COG5325 <97..276 CDD:227635 44/167 (26%)
SNARE 188..247 CDD:304603 21/59 (36%)
SYP23NP_001078403.1 Syntaxin_2 33..133 CDD:291208 36/109 (33%)
SNARE_Qa <204..245 CDD:277193 14/41 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H37823
Inparanoid 1 1.050 109 1.000 Inparanoid score I2020
OMA 1 1.010
OrthoDB 1 1.010 D1204812at2759
OrthoInspector 1 1.000 T32337
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19957
Phylome 1 0.910 0.600 Consistency score
88.080

Return to query results.
Submit another query.