DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: shn and Zfat

Sequence 1:NP_001260883.1 Gene:shn FlyBaseID:FBgn0003396 Length:2587 Species:Drosophila melanogaster
Sequence 2:XP_006241775.1 Gene:Zfat RGDID:1310886 Length:1235 Species:Rattus norvegicus

Alignment Length:1287 Identity:240/1288 (19%)
Similarity:396/1288 (31%) Gaps:480/1288 (37%)


  Fly  1554 NLENVISGKQQELPLTPLHVDTPNGNAPEETSPVASASASAKSKFL-------RPTSLPLKPGTF 1611
            |:::||      :||.||       |.||..:|     :....:||       ||.....||.|.
  Rat    41 NVDDVI------IPLRPL-------NTPENPNP-----SKGGDEFLVMKRKRGRPKGSTKKPSTE 87

  Fly  1612 TPKRHHGITPTANTLPLISPETPRPSKSCVQLYLNGHAYTYLGLKCSTKM--------FYCTV-- 1666
            .....:.::|..:. ||...|..|.:.|.::.           .||..|.        ..|.:  
  Rat    88 EEVVENLVSPIEDG-PLAPEEGSRLAPSSLEC-----------SKCCRKFSNTRQLRKHICIIVL 140

  Fly  1667 NCPQPSYVAGMHKLSMYSVWQV--CEENQPHPLGFKLKQVMALYDSRQRMLGNGSSTAMAGSGK- 1728
            |..:.........|.:...::.  .|:....|...|.::|       |::.|. .:..::|:.| 
  Rat   141 NLGEEGDAGNESDLDLEKTYKEDDREKTSKRPRAQKTEKV-------QKISGK-EAGQLSGAKKP 197

  Fly  1729 -LSYNLVASQQIVSSPSTSSTSSAFYQGPLKT---PPTVTIAALSEANVAAKANEEAQAKKLETS 1789
             :|..|.|.:.|..:.......:    ||.:|   ||..|.|.|    |..:..:|   ..::.:
  Rat   198 IISVVLTAHEAIPGATKIIPVEA----GPPETGAPPPETTAADL----VPRRGYQE---YAIQQT 251

  Fly  1790 PSGQPLVGGYESHEDYTYIRGRGRGRYVCSECGIRCKKPSMLKKHIRTHTDVRPFTCSHCNFSFK 1854
            |..||:   ..|....|.::     .:.|..|....|....|:.|:|.||:.:|:.||.|:::..
  Rat   252 PYEQPM---KSSRLGPTQLK-----IFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCSQCSYASA 308

  Fly  1855 TKGNLTKHMQ-----------------SKTHFKKCIE------------------------LGIN 1878
            .|.||..|::                 ||.|.|..||                        ..|.
  Rat   309 IKANLNVHLRKHTGEKFACDYCSFTCLSKGHLKVHIERVHKKIKQHCRFCKKKYSDVKNLIKHIR 373

  Fly  1879 PGPMPPD---SEFLDVDMDFDQQSSTSAGGR---------TSSMAGESDSD-------------- 1917
            ....|.|   .|.||     :.:..|..|.|         ......|.|.|              
  Rat   374 DMHDPQDKKVKEALD-----ELRLMTREGKRQLLYDCHICERKFKNELDRDRHMLVHGDKWPFAC 433

  Fly  1918 --------DYSDNESE------------------SSDTDESKSRQKEHEAARGLLSLSMTPPIPQ 1956
                    .|...|..                  ||....|..|: .|.||:.  :|..|..|.|
  Rat   434 ELCGHGATKYQALELHVRKHPFVYVCAICLKKFVSSIRLRSHIRE-VHGAAQE--TLVFTSSINQ 495

  Fly  1957 S---VSPYPQLQD----TPLPAASPANSIGSSGSQPKRLVCSFTSPKPPFDYQKQEQYYSNPEES 2014
            |   :.|...:|.    ..||.|:            :..||      |..|.:|.|..   |.|:
  Rat   496 SFCLLEPGGDIQQEALGNQLPLAA------------EEFVC------PEIDVRKGEVC---PGEA 539

  Fly  2015 KPKRS----------------VANEESAPMDL--------------------------------- 2030
            :|:..                :||.:|..:.|                                 
  Rat   540 QPEVGLRELEAPGEACAPAVPLANPQSVSVSLSPCKLETTVVNSDLNSLGVVSDDFLLKTDTSSA 604

  Fly  2031 -----------TKPRGS--------ILLISPSPVSVPAHDLPKSQAQ------------------ 2058
                       |:.|||        .||::.:..:.|..:.|.|..|                  
  Rat   605 EPHAAAELTSDTQHRGSAQTQGEEVTLLLAKAKSTGPDSESPPSGGQNVGALPASESDSNRCLRA 669

  Fly  2059 ---QMHDVI--------FG-------TSGNE-----SGFMKTLISVSDKVRISAEMEEQAKHEAE 2100
               :..|::        .|       ||.:|     :.|||.|.|:..|...::..|...|...:
  Rat   670 NPAETSDLLPTVADGGDLGVCQPDSCTSSSEHHPGSTAFMKVLDSLQKKQMNTSLCERIRKVYGD 734

  Fly  2101 GE--------------DVQLQTYIKEHALHQAKIKQSQFSRSYLINTLYTAASPVMSSSSTLFTA 2151
            .|              |:.::|:.:||..:.::...|..:::.|...:....|.::....|....
  Rat   735 LECEYCGKLFWYQVHFDMHVRTHTREHLYYCSQCHYSSITKNCLKRHVIQKHSNILLKCPTDGCD 799

  Fly  2152 NSRPVMSVNEVPSIEVHEVKTPEAIESPRSAPEQAPVILAQIAQEENEEPNIAEPH-NANLPAAV 2215
            .|.|     :...::.|.....|..:...|.|         :.::...|..:.:.| ..|.|   
  Rat   800 YSTP-----DKYKLQAHLKVHTELDKRSYSCP---------VCEKSFSEDRLIKSHIKTNHP--- 847

  Fly  2216 QQPDVNEFTGVLGNPTAPPTSSVTATSVSTTTAAPVAPSSTANSTQPAQRTVIVGEDGFKSSTP- 2279
             :..:|..:.|||                                :..|...::|:...|  .| 
  Rat   848 -EVSMNTISEVLG--------------------------------RRVQLKGLIGKRAMK--CPY 877

  Fly  2280 ----TSKSG-DLQ-HVSYGRGVPPAPIAGDARPTCTMCSKTFQRQHQLTLHMNIHYMERKFKCEP 2338
                ..|:| ||| |:....||.|.        .|::|....:.:..|..|||.|..|:...|:.
  Rat   878 CDFYFMKNGSDLQRHIWAHEGVKPF--------KCSLCEYATRSKSNLKAHMNRHSTEKTHLCDM 934

  Fly  2339 CSISFRTQGHLQKHERSEAHKNKVMMTSTFGVPTTSNP------------RPFECTDCKIAFRIH 2391
            |...|:::|.|:.|:.......|....:.........|            :||.|..|..:..|.
  Rat   935 CGKKFKSKGTLKSHKLLHTSDGKQFKCTVCDYTAAQKPQLLRHMEQHASFKPFRCAHCHYSCNIS 999

  Fly  2392 GHLAKH-----------------LRSKTHVQK--LEC-LQKLPFGTYAEIER-----AGISLTEI 2431
            |.|.:|                 |.::..:|:  |:| :....:||..|..|     .|:.:.||
  Rat  1000 GSLKRHYNRKHPNEEYANVGSGELAAEALIQQGGLKCPVCSFVYGTKWEFNRHLKNKHGLKVVEI 1064

  Fly  2432 D------------------------TSDCENSLISLKLLAQKLQEKDPGKLSSYTTPSGMMQLAQ 2472
            |                        ..|.:.:..::..| |.|:         ||:.|| .:|..
  Rat  1065 DGDPKWEPATETPEEPSTQYLYITEAEDVQGTQAAVAAL-QDLR---------YTSESG-DRLDP 1118

  Fly  2473 DAAGPVSQ--DSASEDGFSAAIASAIASLDNDSAGNTPKRASSMSEDETVAN 2522
            .|...:.|  :..||...:||:||.:|     .|..|......::::|..:|
  Rat  1119 TAVNILQQIIELGSETHDAAAVASVVA-----MAPGTVTVVKQVTDEEPNSN 1165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
shnNP_001260883.1 C2H2 Zn finger 486..506 CDD:275368
zf-H2C2_2 499..523 CDD:290200
C2H2 Zn finger 514..536 CDD:275368
zf-C2H2 1816..1838 CDD:278523 6/22 (27%)
C2H2 Zn finger 1818..1838 CDD:275370 6/20 (30%)
zf-H2C2_2 1830..1855 CDD:290200 9/25 (36%)
zf-C2H2 1844..1868 CDD:278523 9/41 (22%)
C2H2 Zn finger 1846..1868 CDD:275370 9/39 (23%)
zf-C2H2 2307..2328 CDD:278523 6/21 (29%)
C2H2 Zn finger 2308..2328 CDD:275368 6/20 (30%)
zf-C2H2_jaz 2333..2359 CDD:288983 6/26 (23%)
C2H2 Zn finger 2336..2358 CDD:275368 6/22 (27%)
C2H2 Zn finger 2381..2403 CDD:275368 7/39 (18%)
ZfatXP_006241775.1 zf-C2H2 270..292 CDD:278523 6/22 (27%)
C2H2 Zn finger 272..292 CDD:275368 6/20 (30%)
zf-H2C2_2 284..306 CDD:290200 9/22 (41%)
C2H2 Zn finger 300..320 CDD:275368 7/20 (35%)
C2H2 Zn finger 327..348 CDD:275368 6/21 (29%)
C2H2 Zn finger 355..395 CDD:275368 7/45 (16%)
C2H2 Zn finger 405..425 CDD:275368 3/20 (15%)
C2H2 Zn finger 433..453 CDD:275368 2/20 (10%)
C2H2 Zn finger 459..477 CDD:275368 3/18 (17%)
C2H2 Zn finger 737..757 CDD:275368 2/20 (10%)
C2H2 Zn finger 765..815 CDD:275368 7/55 (13%)
C2H2 Zn finger 825..844 CDD:275368 3/28 (11%)
C2H2 Zn finger 875..896 CDD:275368 7/21 (33%)
C2H2 Zn finger 904..924 CDD:275368 6/20 (30%)
zf-H2C2_2 916..941 CDD:290200 9/25 (36%)
C2H2 Zn finger 932..952 CDD:275368 6/20 (30%)
C2H2 Zn finger 961..981 CDD:275368 1/20 (5%)
C2H2 Zn finger 989..1010 CDD:275368 6/21 (29%)
C2H2 Zn finger 1036..1054 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.833 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.