DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12391 and pita

Sequence 1:NP_610639.1 Gene:CG12391 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster

Alignment Length:433 Identity:90/434 (21%)
Similarity:156/434 (36%) Gaps:111/434 (26%)


  Fly   223 ADVPIRERKKEEPVDEDQCRVCTSKEELVCLFKK--QIDAT---PADMLLVICPNVSILPKDFMP 282
            |.:.:||....|   :..||.|.::::|..:|::  ::..|   |..::.:..  :.:...|.||
  Fly     3 AKLEVREAMLTE---KRVCRFCLTEQKLASIFEENPRVKTTANLPLQIMAITA--IEVYAGDGMP 62

  Fly   283 QFICTKCMGSLTIAIQLRKQLETTDQELRK--RLSRSKNKVRRPRG---------YVVIDAPVTD 336
            ..||.:|........:.::..:..:..||:  ......:.:.:||.         .:|:.|...:
  Fly    63 GHICLECRLLFEHCYRFKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAE 127

  Fly   337 SSEDEDEL-------DDEFKVSDVAGTTSA-------------------------DSDSADSDD- 368
            .||...:|       ..:..:.||....||                         ::.....|| 
  Fly   128 PSETPKKLLNTMAKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDV 192

  Fly   369 --------SEKEKKKPG-PRGRPRKKP----------LKRGTDSDGEPSSAQKK----------- 403
                    ||.||:.|. |:.....||          |.:|..:..||..|..|           
  Fly   193 QSMLEDMASELEKEFPDIPQKASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKRDDSGNVAI 257

  Fly   404 -------------KYQPSSTA---SVGPFECPNCDLTFSRKQSYVLHRKTHERI-EHACPICGKK 451
                         :..|:..|   :...|.||:|:.:|..:|...:||..|.|. ...|.:|.|.
  Fly   258 VTEVLDSDLPLDDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKS 322

  Fly   452 FKVEWAYKTHMQRHEQERAHFRCELCPKIFRLRAELKHHMAQRHDEHGFIYECKRCQRTFLTQQR 516
            |..::....|...|..||. |:|.:|.|.|..:|.|..|.....|...||  |..|::.||::|.
  Fly   323 FFSKYDLAKHNFVHTGERP-FKCAICSKAFTRKALLHRHERTHTDVPKFI--CVYCEKPFLSRQE 384

  Fly   517 LQRHQAVGCQRHKED---SVRIKEEQSRFKQESRSKDDRHHGN 556
            :::|    .:||::.   ...:..:...|||.....:..|..|
  Fly   385 MEKH----AERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTN 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 15/80 (19%)
zf-C2H2 416..438 CDD:278523 8/22 (36%)
C2H2 Zn finger 418..438 CDD:275368 7/20 (35%)
zf-C2H2 443..465 CDD:278523 5/22 (23%)
C2H2 Zn finger 445..465 CDD:275368 5/20 (25%)
C2H2 Zn finger 474..491 CDD:275368 7/17 (41%)
C2H2 Zn finger 504..521 CDD:275368 6/17 (35%)
pitaNP_611806.3 zf-AD 17..92 CDD:214871 15/77 (19%)
COG5048 <281..506 CDD:227381 42/151 (28%)
C2H2 Zn finger 288..308 CDD:275368 7/20 (35%)
C2H2 Zn finger 316..336 CDD:275368 5/20 (25%)
zf-H2C2_2 328..353 CDD:290200 9/26 (35%)
C2H2 Zn finger 344..364 CDD:275368 7/20 (35%)
C2H2 Zn finger 372..388 CDD:275370 5/16 (31%)
C2H2 Zn finger 400..420 CDD:275368 3/20 (15%)
C2H2 Zn finger 428..448 CDD:275368
C2H2 Zn finger 456..476 CDD:275368
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.