DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13229 and dmsr-3

Sequence 1:NP_001260880.1 Gene:CG13229 FlyBaseID:FBgn0033579 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_496818.1 Gene:dmsr-3 WormBaseID:WBGene00012993 Length:376 Species:Caenorhabditis elegans

Alignment Length:345 Identity:75/346 (22%)
Similarity:159/346 (46%) Gaps:57/346 (16%)


  Fly    75 IHGYVSLMICIFGTIANILNIMVLTRKEMAKTPINNILKWLAVADMFVMLEYIPYTSYQYI---- 135
            ||..:.|::||.|.:.::|.|..|:   ....|.|..|..::.:.:.:.:.::..|.::::    
 Worm    24 IHPPMVLLLCISGALGHMLTITTLS---SMLNPTNMFLISMSCSQLALCINFLYSTFFKFMSDQL 85

  Fly   136 --------YMGPGEKDLSYTWAVCLLVHMHFTQILHTISIGLTVTLAVWRYVAIRHPNGGCANFL 192
                    |:.   ..:.::..|.:||||  :.:.|.:::.|   :..:....:...|.....|.
 Worm    86 CQPFFFSYYLA---TTMHFSVTVSVLVHM--SAVFHVVALSL---IRFFSLAQLSSVNSNVQWFT 142

  Fly   193 LAHSREAILLPFILSPILCLPTYFVFQVRETYDVD-------KVNSEAMYHVYFDKDSVLYRFNF 250
            ...||.||::.::....||:|.:|..||.|..:.:       .:.::..|.:.:.:...|...||
 Worm   143 WQKSRVAIIMIYVSVIFLCIPLHFTSQVTEVSENEGCAERYPALRNKVAYQLSYTQSIWLRNLNF 207

  Fly   251 WIHSVLIKLLPCGILIVISAVLMHVLCEASRRRLKLRDYNNPAKYAIQLNLNETKSKKPPRCDRR 315
            |:..::.|::|..||.:::.:::.        :||            ::.:...:.....| |::
 Worm   208 WLFYLVAKVVPSIILCIMTCLILD--------QLK------------KIQVLSARFSSVER-DKQ 251

  Fly   316 NDRTTLLLVAVLVLFLITEFPQGLLGLLSGVME-KCFFAHCYPPFGELMDLLALINAAVGFVLYG 379
            :.|||.:::|:::||:|.|.|||:|.:||.|.. |..:     ..|:|.:|..|:.:.:.|.|..
 Worm   252 HSRTTNMILAIMILFIIVELPQGVLAVLSTVTSVKLIY-----ELGDLTELFTLLTSIIIFTLLC 311

  Fly   380 LMSKQFRTTFRSLFMKRHFG 399
            .|:.:.|:.|:.|...|..|
 Worm   312 SMNGKIRSAFKELSCVRSIG 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13229NP_001260880.1 7tm_4 78..393 CDD:304433 71/335 (21%)
dmsr-3NP_496818.1 7tm_4 40..324 CDD:304433 66/321 (21%)
7tm_1 41..314 CDD:278431 64/310 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BWNV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46273
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.960

Return to query results.
Submit another query.