DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13229 and dmsr-1

Sequence 1:NP_001260880.1 Gene:CG13229 FlyBaseID:FBgn0033579 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_741629.1 Gene:dmsr-1 WormBaseID:WBGene00010191 Length:510 Species:Caenorhabditis elegans

Alignment Length:368 Identity:115/369 (31%)
Similarity:192/369 (52%) Gaps:52/369 (14%)


  Fly    65 IYNWLRAYNSIHGYVSLMICIFGTIANILNIMVLTRKEMAKTPINNILKWLAVADMFVMLEYIPY 129
            :||:   |:.||.|:|:.:|:.|||||..||:||||:.| :||:|.||..:|..|..|:...:.|
 Worm    26 VYNF---YHPIHAYLSIFLCVLGTIANFCNIVVLTRRTM-RTPVNMILTAMASCDTVVLFSNLIY 86

  Fly   130 TS-YQYI---YMGPGEKDLSYTWAVCLLVHMHFTQILHTISIGLTVTLAVWRYVAIR-HPNGGCA 189
            |: |.::   :..|  |..||:||:.|:.|.|.:.:.|:.|:.|:|.||:.|||.:| ..|.|..
 Worm    87 TTHYSFVAFKFCHP--KHWSYSWALFLIAHAHLSLVAHSSSVWLSVMLALVRYVTLRSRGNMGGM 149

  Fly   190 NFLLAHSREAILLPFILSPILCLPTYFVFQVRE------TYDVDKV--NSEAMYHVYFD----KD 242
            ...|.||..|:.:...|..:|..|.:..:::.|      ..|:|.:  ||.|......|    ..
 Worm   150 QVTLRHSYYAVAVTVSLVAVLNAPNFLNYKINEQPLNETCTDLDPMFWNSPAYLPGIADIAKANS 214

  Fly   243 SVLYRFNFWIHSVLIKLLPCGILIVISAVLMHVLCEA--SRRRLKLRDYNNPAKYAIQLNLNETK 305
            .:::|.::||..::.|:|||.:|.:...:|:.:|.|.  :|:||.....:.|.        |:|.
 Worm   215 CLVFRLSYWISGMVFKVLPCALLSLFVWLLLRILREVRENRQRLLKNSQHRPP--------NQTT 271

  Fly   306 SKKPPRCD-------------------RRNDRTTLLLVAVLVLFLITEFPQGLLGLLSGVMEKCF 351
            ::...|..                   .|.||||.:|:|::.:.|:||.|||::.:|||:..:.|
 Worm   272 TRNGQRLSISVAGNEKLGRNGSLRGRGERVDRTTHMLLAIVAVMLVTELPQGIMAVLSGMCSEEF 336

  Fly   352 FAHCYPPFGELMDLLALINAAVGFVLYGLMSKQFRTTFRSLFM 394
            ..:.|...|:::||.:|..:...|::|..||.|||..|..:|:
 Worm   337 RIYIYNNLGDILDLFSLCGSCCSFIIYCSMSGQFRNEFHRVFV 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13229NP_001260880.1 7tm_4 78..393 CDD:304433 109/353 (31%)
dmsr-1NP_741629.1 7tm_4 36..378 CDD:304433 109/353 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BWNV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 190 1.000 Inparanoid score I2529
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D343117at33208
OrthoFinder 1 1.000 FOG0013862
OrthoInspector 1 1.000 T374768
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46273
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R16963
TreeFam 1 0.960
99.060

Return to query results.
Submit another query.