DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb5 and POLR2E

DIOPT Version :8

Sequence 1:NP_001260878.1 Gene:Rpb5 / 36160 FlyBaseID:FBgn0033571 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_011526372.1 Gene:POLR2E / 5434 HGNCID:9192 Length:211 Species:Homo sapiens

Alignment Length:210 Identity:178/211 (84%)
Similarity:190/211 (90%) Gaps:1/211 (0%)


  Fly     1 MDDEAETYKLWRIRKTIMQLSHDRGYLVTQDELDQTLEQFKEMFGDKPSEKRPARSDLIVLVAHN 65
            ||||.|||:||:||||||||.|||||||||||||||||:||...||||||.||.|:||.||||||
Human     1 MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHN 65

  Fly    66 DDPTDQMFVFFPEEPKIGIKTIKTYCTRMQEENIHRAIVVVQGGMTPSAKQSLVDMAPKYILEQF 130
            ||||||||||||||||:||||||.||.|||||||.||::|||.||||||||||||||||||||||
Human    66 DDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQF 130

  Fly   131 LESELLINITEHELVPEHVVMTVEEKQELLSRY-KLKENMLMRIQAGDPVARYFGLKRGQVVKII 194
            |:.|||||||||||||||||||.||..|||:|| ||:||.|.|||||||||||||:|||||||||
Human   131 LQQELLINITEHELVPEHVVMTKEEVTELLARYSKLRENQLPRIQAGDPVARYFGIKRGQVVKII 195

  Fly   195 RSSETAGRYISYRLV 209
            |.||||||||:||||
Human   196 RPSETAGRYITYRLV 210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rpb5NP_001260878.1 PLN03111 1..210 CDD:215582 178/211 (84%)
RNA_pol_Rpb5_N 4..91 CDD:281816 73/87 (84%)
RNA_pol_Rpb5_C 138..209 CDD:279524 61/72 (85%)
POLR2EXP_011526372.1 PLN03111 1..210 CDD:215582 177/209 (85%)
RNA_pol_Rpb5_N 4..92 CDD:281816 74/88 (84%)
RNA_pol_Rpb5_C 138..210 CDD:279524 61/72 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C176323207
eggNOG 1 0.900 E1_COG2012
Hieranoid 1 1.000
Homologene 1 1.000 H2018
Inparanoid 1 1.050 360 1.000 Inparanoid score I2181
Isobase 1 0.950 0 Normalized mean entropy S297
OMA 1 1.010
OrthoDB 1 1.010 D1255823at2759
OrthoFinder 1 1.000 FOG0003086
OrthoInspector 1 1.000 T1072988
orthoMCL 1 0.900 OOG5_127455
Panther 1 1.100 LDO PTHR10535
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1175
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.