DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12942 and CG31365

Sequence 1:NP_610628.2 Gene:CG12942 FlyBaseID:FBgn0033569 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster

Alignment Length:755 Identity:142/756 (19%)
Similarity:247/756 (33%) Gaps:237/756 (31%)


  Fly     1 MDA--AVPDPALLAMNKLNKGSKCRACLS--------VDRKTVQLNAEVPNLQKTRTYAQSLKQC 55
            |||  :.||.|.|          ||.||.        .|....||:..|           .|..|
  Fly     1 MDAQPSYPDLATL----------CRLCLKEHQDAYAIFDEDDTQLSIPV-----------RLMAC 44

  Fly    56 TNLDLRVISPGGYLWPMQICVRCCRALEVAMHFVEMALESNLKLQAEAKSVKLPSPTGELKRKAS 120
            ..||.:...    ..|.:||..|...||.:..|.:....:..||:...:.:.|    |:..|..|
  Fly    45 VALDAKATD----TLPKRICQECRYQLEKSFLFRQRCQWAEKKLRKHIRLLGL----GKRSRVFS 101

  Fly   121 NETIPWNQFSQEFEQ---FVEGYEGPIEENVLYMRGTK------------------VPRLDVDAS 164
            .:...:::...|||.   |:|     :::.|..:...|                  ..||::.|.
  Fly   102 KDPDDYDEDELEFEDSIAFIE-----VQDKVRKLEDEKWREDFKEEQAAEMHKRLVKSRLELRAK 161

  Fly   165 SSSETAPKEDEVILFDVKYDTNDLEEEDENDGSDAKNNETFFENSITPGESVMVVSVAEKAVENN 229
            .::|...:..|.:..:|:   .:|.||..:...|...||                 |:|      
  Fly   162 LTTELRKELAEEVRSEVR---KELAEEVRSQVRDDLRNE-----------------VSE------ 200

  Fly   230 NNYNFNNKNGDVTDEECDLIQRALEMTLND---------DGCSQSPK---NEASNETQLKSNGIE 282
                      |:..|:..::...||:.|.:         ||.....|   .|.::.::.|:..:.
  Fly   201 ----------DIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALP 255

  Fly   283 VSSPLFIKLATTSSTTGNIP------ILKCNICQYTHTDA--------EQLKIHY-KSIHKISMM 332
            ...|..:. |...:|.....      ||.||.....::|.        |::.... :...:|:|:
  Fly   256 KRRPSLVD-ANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMV 319

  Fly   333 EDDII------------GLNKNQNFKCRP-------CNSYETKDRSEMQ---------------- 362
            ..|::            ..:::||....|       ..||..|:..|:|                
  Fly   320 GSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFN 384

  Fly   363 ---------------KHLIDHHKIDGDFEMYCYMQANCPACDRIFKDQRSARKHYT-RVHTPVQI 411
                           :::|...|...|.:....::.. .:.:.:||.:.|..:..| |:...|  
  Fly   385 LGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRK-RSSELVFKQESSCPQPKTGRITDTV-- 446

  Fly   412 AVSPTESYACTACDKVFNQKASLHSHQRFCQVKDV-------VHCSFCDQQFNSMRKYELHLQQL 469
                 :|:.|..|...|..:..|..|.. ..:|.:       :.|..|..|.:.....:.|: .:
  Fly   447 -----KSFQCHLCPVAFPTQKLLTRHHN-THIKGLKSGKGGTLKCPSCALQLSCASSLKRHM-II 504

  Fly   470 HAVETVHECEICRRSFKSAETLTMHRKRHS--ERHYQCGKCSLNYVNSAELRVHYERAHV-NEEP 531
            |......:|..|..||...|.|..|...|:  :|| ||.:||..:...:.|:.|..|.|: |...
  Fly   505 HTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRH-QCPQCSSCFAQKSNLQQHIGRVHMGNSRT 568

  Fly   532 VSCLTCGNQFQNMTLLREHEQRSHQKSKVWRCEVCNFETKTRWRRRQHQYEHMDYPYKCQKCTSE 596
            ..|..|...|.:::.|                             .:|...|....:.|::|..:
  Fly   569 HKCHLCHRSFNHVSGL-----------------------------SRHLVTHAGVMFSCKQCGRQ 604

  Fly   597 FADRSKFRQHSKKVHGIELSDEQLAEMFREKKGYTNRHDA 636
            |.|||..::|...:|.::   .:|.:...|    ||...|
  Fly   605 FNDRSAVQRHVTTMHKVK---NKLTDYISE----TNEFQA 637

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12942NP_610628.2 zf-AD 22..101 CDD:285071 21/87 (24%)
C2H2 Zn finger 385..406 CDD:275368 5/22 (23%)
C2H2 Zn finger 421..470 CDD:275368 10/56 (18%)
C2H2 Zn finger 449..466 CDD:275371 4/17 (24%)
C2H2 Zn finger 478..498 CDD:275368 7/20 (35%)
C2H2 Zn finger 505..526 CDD:275368 6/21 (29%)
C2H2 Zn finger 534..555 CDD:275368 4/21 (19%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 22/98 (22%)
vATP-synt_E 109..>244 CDD:304907 30/176 (17%)
RRF <161..222 CDD:294170 16/97 (16%)
zf-C2H2_8 454..530 CDD:292531 17/78 (22%)
C2H2 Zn finger 485..505 CDD:275368 4/21 (19%)
zf-H2C2_2 497..522 CDD:290200 6/26 (23%)
C2H2 Zn finger 513..533 CDD:275368 7/20 (35%)
zf-H2C2_2 526..550 CDD:290200 9/25 (36%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 5/49 (10%)
C2H2 Zn finger 598..617 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24377
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.