DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cag and JRKL

Sequence 1:NP_001260876.1 Gene:cag FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001248762.1 Gene:JRKL HGNCID:6200 Length:524 Species:Homo sapiens

Alignment Length:176 Identity:49/177 (28%)
Similarity:90/177 (51%) Gaps:17/177 (10%)


  Fly     7 RKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQS-IKEGLLSGELKLNQM 70
            ::.|..||:::|:::|:..|... |.:.||..:.||:|...||.|:|:. |.....|....|...
Human     4 KRKRVVLTIKDKLDIIKKLEDGG-SSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAK 67

  Fly    71 RRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELG-HSNFSASSGWLEKWRKR 134
            |::.......::|....:||::.|.:..||||.:..|:|:.....|| ..:|:.|:|||.::::|
Human    68 RKSMKPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRAEFFFYALGMDGDFNPSAGWLTRFKQR 132

  Fly   135 HNVR----YND--TGDSLDLQEF--------EAILVKSEPISNKDD 166
            |::|    .|:  .||...:::|        |...::.|.|.|.|:
Human   133 HSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADE 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 17/54 (31%)
CENPB 78..141 CDD:197828 21/68 (31%)
JRKLNP_001248762.1 HTH 4..52 CDD:304362 16/49 (33%)
CENPB 73..139 CDD:197828 20/66 (30%)
DDE_1 206..385 CDD:281213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343623at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T609166
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.