DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cag and TIGD6

Sequence 1:NP_001260876.1 Gene:cag FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001230182.1 Gene:TIGD6 HGNCID:18332 Length:521 Species:Homo sapiens

Alignment Length:130 Identity:46/131 (35%)
Similarity:70/131 (53%) Gaps:3/131 (2%)


  Fly     8 KPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKLNQMRR 72
            |.|...:|||||:|:.:.:..|.. .|:||.|.|..:..:..||.:...:|.:  .|..:...|:
Human     7 KKRRQFSLEEKMKVVGAVDSGKRK-GDVAKEFGITPSTLSTFLKDRTKFEEKV--REASVGPQRK 68

  Fly    73 NPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRKRHNV 137
            ...|.....||:..|.||..:..:||.::|.::||||..||..||:.||.||.|||.::|.||.:
Human    69 RMRSALYDDIDKAVFAWFQEIHAKNILVTGSVIRKKALNLANMLGYDNFQASVGWLNRFRDRHGI 133

  Fly   138  137
            Human   134  133

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 17/52 (33%)
CENPB 78..141 CDD:197828 26/61 (43%)
TIGD6NP_001230182.1 InsE 5..>57 CDD:225511 17/51 (33%)
HTH 7..54 CDD:304362 16/48 (33%)
HTH_Tnp_Tc5 75..134 CDD:281246 26/60 (43%)
rve 207..372 CDD:304425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343623at2759
OrthoFinder 1 1.000 FOG0000794
OrthoInspector 1 1.000 T609166
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R10
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.