DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and zgc:113274

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001018331.2 Gene:zgc:113274 / 552925 ZFINID:ZDB-GENE-050508-2 Length:203 Species:Danio rerio


Alignment Length:185 Identity:46/185 - (24%)
Similarity:72/185 - (38%) Gaps:37/185 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSGRVRKPR-TSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGE 64
            ||...:||.. .|:|.||..:.....:|.| |:|.:||...||::.....:|             
Zfish     1 MPRNYIRKTDWGSVTYEELEKAFVEVKRGK-SIRTVAKERKIGRSTLQRYMK------------- 51

  Fly    65 LKLNQMRRNPLSQRG-AQIDEMCFDWFSRVRTENIPISGEMVR----KKAKQLAVELGH------ 118
             |..:.|...:..|| |:...:..:.......|||.|..|.||    ||.:::|.|...      
Zfish    52 -KAEERRERTVGYRGTAEAKRIFSEELEEELAENIRIMSERVRGLATKKCREIAFEFAQKHNIPV 115

  Fly   119 -SNFS----ASSGWLEKWRKRHNVRYNDTGDSLDL----QEFEAILVKSEPISNK 164
             :|:.    |...||..:..|||: |....::..|    |.....||..:.|.::
Zfish   116 PNNWGEQRLAGRDWLSSFINRHNL-YGHLTEAASLESHGQGIRLSLVNHDEIKSE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 15/53 (28%)
CENPB 78..141 CDD:197828 22/78 (28%)
zgc:113274NP_001018331.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.