DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cag and zgc:113274

Sequence 1:NP_001260876.1 Gene:cag FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001018331.2 Gene:zgc:113274 ZFINID:ZDB-GENE-050508-2 Length:203 Species:Danio rerio

Alignment Length:185 Identity:46/186 (25%)
Similarity:72/186 (39%) Gaps:37/186 (20%)


  Fly     1 MPSGRVRKPR-TSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGE 64
            ||...:||.. .|:|.||..:.....:|.| |:|.:||...||::.....:|             
Zfish     1 MPRNYIRKTDWGSVTYEELEKAFVEVKRGK-SIRTVAKERKIGRSTLQRYMK------------- 51

  Fly    65 LKLNQMRRNPLSQRG-AQIDEMCFDWFSRVRTENIPISGEMVR----KKAKQLAVELGH------ 118
             |..:.|...:..|| |:...:..:.......|||.|..|.||    ||.:::|.|...      
Zfish    52 -KAEERRERTVGYRGTAEAKRIFSEELEEELAENIRIMSERVRGLATKKCREIAFEFAQKHNIPV 115

  Fly   119 -SNFS----ASSGWLEKWRKRHNVRYNDTGDSLDL----QEFEAILVKSEPISNK 164
             :|:.    |...||..:..|||: |....::..|    |.....||..:.|.::
Zfish   116 PNNWGEQRLAGRDWLSSFINRHNL-YGHLTEAASLESHGQGIRLSLVNHDEIKSE 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 15/54 (28%)
CENPB 78..141 CDD:197828 22/79 (28%)
zgc:113274NP_001018331.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343623at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.