DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and ebd2

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001246865.1 Gene:ebd2 / 40363 FlyBaseID:FBgn0037076 Length:367 Species:Drosophila melanogaster


Alignment Length:144 Identity:36/144 - (25%)
Similarity:67/144 - (46%) Gaps:7/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLS-----GELK 66
            |..|..||..||:.||:..:...:|...|||.|:...||...||..|:.:.:.|.:     ..:.
  Fly    27 RNERNILTFYEKIAVIRYYDETNISRNSLAKMFHCCATQIRRILDKKKDLLQQLATLSEADASII 91

  Fly    67 LNQMRRNPLSQRGAQIDEMCFDWFSR-VRTE-NIPISGEMVRKKAKQLAVELGHSNFSASSGWLE 129
            :.:|.|.......:.|..:..:|..| ::.: ||.|..:.:::.|.::|..|...:|..|..||.
  Fly    92 IEEMTRKRRKFEMSAISFLLHEWVERCIQMQLNISIRNQKLKETAIRMAAVLNLPSFRPSYRWLS 156

  Fly   130 KWRKRHNVRYNDTG 143
            ::|.::....::.|
  Fly   157 RFRNKYKYEADELG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 18/52 (35%)
CENPB 78..141 CDD:197828 14/64 (22%)
ebd2NP_001246865.1 CENP-B_N 27..80 CDD:282122 18/52 (35%)
CENPB 101..166 CDD:197828 14/64 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.