powered by:
                   
 
    
    
             
          
            Protein Alignment cag and ebd2
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001260876.1 | Gene: | cag / 36157 | FlyBaseID: | FBgn0017414 | Length: | 225 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001246865.1 | Gene: | ebd2 / 40363 | FlyBaseID: | FBgn0037076 | Length: | 367 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 144 | Identity: | 36/144 - (25%) | 
          
            | Similarity: | 67/144 -  (46%) | Gaps: | 7/144 - (4%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     7 RKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLS-----GELK 66|..|..||..||:.||:..:...:|...|||.|:...||...||..|:.:.:.|.:     ..:.
 Fly    27 RNERNILTFYEKIAVIRYYDETNISRNSLAKMFHCCATQIRRILDKKKDLLQQLATLSEADASII 91
 
 
  Fly    67 LNQMRRNPLSQRGAQIDEMCFDWFSR-VRTE-NIPISGEMVRKKAKQLAVELGHSNFSASSGWLE 129:.:|.|.......:.|..:..:|..| ::.: ||.|..:.:::.|.::|..|...:|..|..||.
 Fly    92 IEEMTRKRRKFEMSAISFLLHEWVERCIQMQLNISIRNQKLKETAIRMAAVLNLPSFRPSYRWLS 156
 
 
  Fly   130 KWRKRHNVRYNDTG 143::|.::....::.|
 Fly   157 RFRNKYKYEADELG 170
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 0 | 0.000 | Not matched by this tool. | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 1 | 0.910 |  | 
        
      
           
             Return to query results.
             Submit another query.