DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cag and Tigd3

Sequence 1:NP_001260876.1 Gene:cag FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001101043.1 Gene:Tigd3 RGDID:1305393 Length:470 Species:Rattus norvegicus

Alignment Length:193 Identity:54/194 (28%)
Similarity:95/194 (49%) Gaps:27/194 (14%)


  Fly     7 RKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKLNQMR 71
            :|...:|:|.||::|::..:.:|:|..::|:||.:.:.|.:.|.|:|:.:.....||  ..|..|
  Rat     6 KKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWCSG--TANHER 68

  Fly    72 RNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRKRHN 136
            :.....:.:.|||....|:...|.:...::|.|:..|||:||..:| .:|..|.|||.:|::|:|
  Rat    69 KRKRESKYSGIDEALLCWYHIARAKAWDVTGPMLLHKAKELADIMG-QDFVPSIGWLVRWKRRNN 132

  Fly   137 VRYNDTGDSLDLQEFEAILVKSEPISNKDDCDEPYPVTLIEPIYSTEEAMMQLARLKEFAKDD 199
            |.:..          ..:||...|         |.|    .|..|..:|...|: ||:|:.:|
  Rat   133 VGFGT----------RQVLVPLLP---------PEP----PPAVSPSQAQPPLS-LKDFSPED 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 15/53 (28%)
CENPB 78..141 CDD:197828 22/63 (35%)
Tigd3NP_001101043.1 HTH 6..57 CDD:304362 15/51 (29%)
HTH_Tnp_Tc5 76..133 CDD:281246 21/58 (36%)
rve 193..360 CDD:304425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343623at2759
OrthoFinder 1 1.000 FOG0000794
OrthoInspector 1 1.000 T618104
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.