DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and Tigd3

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001101043.1 Gene:Tigd3 / 309174 RGDID:1305393 Length:470 Species:Rattus norvegicus


Alignment Length:193 Identity:54/193 - (27%)
Similarity:95/193 - (49%) Gaps:27/193 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKLNQMR 71
            :|...:|:|.||::|::..:.:|:|..::|:||.:.:.|.:.|.|:|:.:.....||  ..|..|
  Rat     6 KKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWCSG--TANHER 68

  Fly    72 RNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRKRHN 136
            :.....:.:.|||....|:...|.:...::|.|:..|||:||..:| .:|..|.|||.:|::|:|
  Rat    69 KRKRESKYSGIDEALLCWYHIARAKAWDVTGPMLLHKAKELADIMG-QDFVPSIGWLVRWKRRNN 132

  Fly   137 VRYNDTGDSLDLQEFEAILVKSEPISNKDDCDEPYPVTLIEPIYSTEEAMMQLARLKEFAKDD 199
            |.:..          ..:||...|         |.|    .|..|..:|...|: ||:|:.:|
  Rat   133 VGFGT----------RQVLVPLLP---------PEP----PPAVSPSQAQPPLS-LKDFSPED 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 15/52 (29%)
CENPB 78..141 CDD:197828 22/62 (35%)
Tigd3NP_001101043.1 HTH 6..57 CDD:419669 15/50 (30%)
HTH_Tnp_Tc5 76..133 CDD:397365 20/57 (35%)
rve 193..360 CDD:419726
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 1 1.000 - - otm44569
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.