DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment cag and Pogk

DIOPT Version :9

Sequence 1:	NP_001260876.1	Gene:	cag / 36157	FlyBaseID:	FBgn0017414	Length:	225	Species:	Drosophila melanogaster
Sequence 2:	NP_001100664.2	Gene:	Pogk / 304941	RGDID:	1308951	Length:	622	Species:	Rattus norvegicus

Alignment Length:	139	Identity:	32/139 - (23%)
Similarity:	62/139 - (44%)	Gaps:	31/139 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly    30 LSVRDLAKRFNI--GKTQAAD------ILKHKQSIKE-------GLLSGELK-----------LN 68
            ||..|||.:|..  |..::.|      :::|.:|...       |:|...::           .:
  Rat   200 LSADDLASKFQFSRGMRRSYDAGFKLMVVEHAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAH 264

  Fly    69 QMR---RNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELG--HSNFSASSGWL 128
            .||   |.|.:.|.|.:|:...::...::.:..||:.|.::.||.::|.|:.  ...|.||.||.
  Rat   265 AMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWC 329

  Fly   129 EKWRKRHNV 137
            .:..:|:::
  Rat   330 RRMMRRYDL 338

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
cag	NP_001260876.1	CENP-B_N	7..60	CDD:282122	10/44 (23%)
cag	NP_001260876.1	CENPB	78..141	CDD:197828	16/62 (26%)
Pogk	NP_001100664.2	KRAB	68..123	CDD:214630
		KRAB_A-box	68..105	CDD:143639
		BrkDBD	214..266	CDD:286662	6/51 (12%)
		CENPB	275..342	CDD:197828	16/64 (25%)
		DDE_1	414..586	CDD:281213
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3105
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1343623at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.820