DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and Jrk

DIOPT Version :9

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_032441.4 Gene:Jrk / 16469 MGIID:106214 Length:557 Species:Mus musculus


Alignment Length:208 Identity:55/208 - (26%)
Similarity:91/208 - (43%) Gaps:28/208 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GRVRKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELK-- 66
            |..|| |..|||:||:::....||.: |.:.|.:.:|:|.:...||..||..:.....|.:.:  
Mouse    12 GEKRK-RVVLTLKEKIDICTRLERGE-SRKALMQEYNVGMSTLYDIKAHKAQLLRFFASSDSRQA 74

  Fly    67 LNQMRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSA-SSGWLEK 130
            |.| ||...:.:...:|.:.::||...|.|.||:||.|:.:|||....::..:.... |.|||.:
Mouse    75 LEQ-RRTLHTPKLEHLDRVLYEWFLVKRAEGIPVSGPMLIEKAKDFYKQMRLTEPCVFSGGWLWR 138

  Fly   131 WRKRHNVRYNDTGDSLDLQEFEAI---------LVKSEPISNKDDCDEPYPVTLIEPIYSTEEAM 186
            ::.||.::..|........:.:|.         |.....:|.             |.:||.:|..
Mouse   139 FKARHGIKKLDASSEKQAADHQAAEQFCGFFRSLAAEHGLSP-------------EQVYSADETG 190

  Fly   187 MQLARLKEFAKDD 199
            :....|...|.||
Mouse   191 LVWRCLPNSAPDD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 18/52 (35%)
CENPB 78..141 CDD:197828 19/63 (30%)
JrkNP_032441.4 CENP-B_N 14..66 CDD:282122 18/53 (34%)
CENPB 83..147 CDD:197828 19/63 (30%)
DDE_1 213..382 CDD:281213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343623at2759
OrthoFinder 1 1.000 - - FOG0000365
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.