DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cag and LOC108644771

Sequence 1:NP_001260876.1 Gene:cag FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_017944980.1 Gene:LOC108644771 ID: Length:1271 Species:Xenopus tropicalis

Alignment Length:196 Identity:45/197 (23%)
Similarity:84/197 (43%) Gaps:24/197 (12%)


  Fly     7 RKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKLNQMR 71
            ::.|.|.....|:||:...|.:..|:  .::.|.:.:.|..:..|.|..:::     ..|..:.|
 Frog   837 KQKRRSYEAAFKLEVVSRAEESNNSI--ASEEFCVDEKQVREWRKMKAGLEK-----IPKTKKAR 894

  Fly    72 RNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVE-----LGHSNFSASSGWLEKW 131
            |..::..||..:|: .:|....|.....|:...:|.:|.|:|.:     .|...|.||:||..::
 Frog   895 RGLITSYGALENEL-HEWVLECRQNGDCITRMGIRLRALQMAKDDKYKAPGIEKFVASAGWCTRF 958

  Fly   132 RKRHNVRYND-TGDSL--DLQE----FEAILVKSEPISNKDDCD----EPYPVTLIEPIYSTEEA 185
            ..|..:.... |...|  ||:|    |::.:::...|.|.|..|    :..|:|...|...|..:
 Frog   959 MNRFELCLRQRTLQKLPQDLEEKVMSFQSFIIEQRRIHNYDLVDIGNMDEIPMTFDLPSNKTAAS 1023

  Fly   186 M 186
            :
 Frog  1024 L 1024

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 11/53 (21%)
CENPB 78..141 CDD:197828 17/68 (25%)
LOC108644771XP_017944980.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343623at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.