DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cag and CENPB

DIOPT Version :8

Sequence 1:NP_001260876.1 Gene:cag / 36157 FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001801.1 Gene:CENPB / 1059 HGNCID:1852 Length:599 Species:Homo sapiens

Alignment Length:134 Identity:47/135 (35%)
Similarity:81/135 (60%) Gaps:12/135 (9%)


  Fly    10 RTSLTLEEKMEVIQSQERN-KLSVRDLAKRFNIGKTQAADILKHKQSI-----KEGLLSGELKLN 68
            |..||..||..:||..|.| .|...::|:||||..:..:.|||:|::|     |.|:.|...|.|
Human     5 RRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTN 69

  Fly    69 QMRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRK 133
            ::  :|..    :::.:...||.::|...:|:.|.::::||.::|.|||..:|:||:|||:::|:
Human    70 KL--SPYD----KLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASNGWLDRFRR 128

  Fly   134 RHNV 137
            ||.|
Human   129 RHGV 132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 22/56 (39%)
CENPB 78..141 CDD:197828 21/61 (34%)
CENPBNP_001801.1 DNA binding domain 1..125 43/126 (34%)
CENP-B_N 2..56 CDD:282122 20/51 (39%)
CENPB 74..135 CDD:197828 21/64 (33%)
DDE_1 222..384 CDD:281213
CENP-B_dimeris <539..598 CDD:286159
dimerization domain 541..599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343623at2759
OrthoFinder 1 1.000 FOG0000794
OrthoInspector 1 1.000 T609166
orthoMCL 1 0.900 OOG5_140316
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R10
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.