DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cag and Tigd5

Sequence 1:NP_001260876.1 Gene:cag FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_848761.2 Gene:Tigd5 MGIID:2145902 Length:642 Species:Mus musculus

Alignment Length:135 Identity:33/136 (24%)
Similarity:65/136 (48%) Gaps:13/136 (10%)


  Fly    10 RTSLTLEEKMEVIQ---SQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGL--LSGELKLNQ 69
            |.:.::::|::.|:   ..||.....||    |.:........||.:..::..|  |.||:...:
Mouse    63 RKAYSIKDKLQAIERVKGGERQASVCRD----FGVPGGTLRGWLKDEPKLRWFLDQLGGEVGTQR 123

  Fly    70 MRRNPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVEL--GHSNFSASSGWLEKWR 132
            .:....::.  :||...:.||..:|...:|:||.:::.:|:..|.::  ....|.||.||..:|:
Mouse   124 KKMRLANEE--EIDRAVYSWFLTLRQHGVPLSGPVIQAQAEAFARQIYGPECTFKASHGWFWRWQ 186

  Fly   133 KRHNV 137
            |||.:
Mouse   187 KRHGI 191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 10/53 (19%)
CENPB 78..141 CDD:197828 19/63 (30%)
Tigd5NP_848761.2 HTH 63..112 CDD:304362 10/53 (19%)
HTH_Tnp_Tc5 132..192 CDD:281246 19/63 (30%)
rve 280..486 CDD:304425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343623at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T615985
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.