DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cag and Tigd4

Sequence 1:NP_001260876.1 Gene:cag FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_006224221.1 Gene:Tigd4 RGDID:1305780 Length:514 Species:Rattus norvegicus

Alignment Length:153 Identity:43/154 (28%)
Similarity:82/154 (53%) Gaps:10/154 (6%)


  Fly     8 KPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKLNQMRR 72
            |.:.||::|||:::|.:.|..|... ::|..:.|.|...:.|:|:|..:.|...|  |:.:..|:
  Rat    16 KKKKSLSIEEKIDIINAVESGKKKA-EIAAEYGIKKNSLSSIMKNKDKVLEAFES--LRFDPKRK 77

  Fly    73 NPLSQRGAQIDEMCFDWFSRVRTENIPISGEMVRKKAKQLAVELGHSNFSASSGWLEKWRKRHNV 137
            ...:.....::|....|:...:..|:|::|.|:|.||...|.:|||::|..|:|||::::.|:.:
  Rat    78 RLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQKLGHNDFKCSNGWLDRFKSRYGL 142

  Fly   138 RYNDTGDSLDLQEFEAILVKSEP 160
            .:.       .|..||..|.::|
  Rat   143 VFR-------AQPVEATGVSTDP 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 16/52 (31%)
CENPB 78..141 CDD:197828 19/63 (30%)
Tigd4XP_006224221.1 HTH 16..67 CDD:304362 16/52 (31%)
HTH_Tnp_Tc5 84..143 CDD:281246 19/59 (32%)
rve 211..375 CDD:304425
CENP-B_dimeris 428..>506 CDD:286159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343623at2759
OrthoFinder 1 1.000 FOG0000794
OrthoInspector 1 1.000 T618104
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.