DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cag and LOC100287896

Sequence 1:NP_001260876.1 Gene:cag FlyBaseID:FBgn0017414 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001306169.1 Gene:LOC100287896 ID: Length:392 Species:Homo sapiens

Alignment Length:171 Identity:40/172 (23%)
Similarity:90/172 (52%) Gaps:9/172 (5%)


  Fly     3 SGRVRKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADILKHKQSIKEGLLSGELKL 67
            |.:.::....|::.:|:::::..: :.:||:.|.:.:.:|.|...|:.|.|..:.:.....:.::
Human    56 SDKKKRKHLCLSIAQKVKLLEKLD-SGVSVKHLTEEYGVGMTTIYDLKKQKDKLLKFYAESDEQI 119

  Fly    68 NQMRRNPLSQ-RGAQIDEMCFDWFSRVRTENIPISGEMVRKKAK----QLAVELGHSNFSASSGW 127
            ....|..|.: :...:|.:..:|..:.|:|::|::|.::.|:||    :|.:|   .|...|:||
Human   120 LMKNRKTLHKAKNEDLDRVLKEWIRQRRSEHMPLNGMLIMKQAKIYHNELKIE---GNCEYSTGW 181

  Fly   128 LEKWRKRHNVRYNDTGDSLDLQEFEAILVKSEPISNKDDCD 168
            |:|::|||.:::..|..:......||....:...||.|:.|
Human   182 LQKFKKRHGIKFLKTCGNKASAGHEATEKFTGKFSNDDEQD 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cagNP_001260876.1 CENP-B_N 7..60 CDD:282122 10/53 (19%)
CENPB 78..141 CDD:197828 20/67 (30%)
LOC100287896NP_001306169.1 HTH 66..99 CDD:304362 7/34 (21%)
HTH_Tnp_Tc5 132..192 CDD:281246 20/63 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1343623at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.