DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12343 and syf2

Sequence 1:NP_610617.1 Gene:CG12343 FlyBaseID:FBgn0033556 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001003437.1 Gene:syf2 ZFINID:ZDB-GENE-040801-170 Length:238 Species:Danio rerio

Alignment Length:226 Identity:125/227 (55%)
Similarity:165/227 (73%) Gaps:3/227 (1%)


  Fly     2 EKTKT-AAEKLAERKARLLDLHKKRQEARTDNHQEVVAEDARKKLPKNWEARKRQAEWILADDKA 65
            |.|:| ||:|..||..:..:||.||.|||..||||||.||.|.|||.||||:|.:.|:.|..|:.
Zfish    15 EVTETPAAQKREERLRKFRELHFKRNEARKLNHQEVVEEDKRLKLPSNWEAKKARLEYELLVDQK 79

  Fly    66 RAEAQAAGKDYERLKLLEVSAVDADRIEKKKKRKDNPDLGFSTYEAQTARQYNRLVKSMPARDLE 130
            :.|....|:||:|:||||:||.||:|.|:|||:: |||.|||.|.....|||.||.|.:.. |:|
Zfish    80 KKECAERGEDYDRVKLLEISAEDAERWERKKKKR-NPDPGFSGYAEAQLRQYQRLTKQIKP-DME 142

  Fly   131 KYERQKEELGDAFYGGAHTTLHSRTKDTPGAINKMVTDLEQQIERRKKYSRRRIYNDDADVDFIN 195
            .||:||||.|:.|:..:::.::.....:..:||:||.|:|:|||:|.||||||.||||||:|:||
Zfish   143 NYEKQKEECGEDFHPTSNSLIYGTHVPSKDSINRMVDDVEKQIEKRAKYSRRRAYNDDADIDYIN 207

  Fly   196 ERNSKFNKKLDRFYSEHTAEIKQNLERGTAI 226
            |||:|||||.:|||.::|||||||||||||:
Zfish   208 ERNAKFNKKAERFYGKYTAEIKQNLERGTAV 238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12343NP_610617.1 SYF2 71..221 CDD:285444 84/150 (56%)
syf2NP_001003437.1 SYF2 85..233 CDD:285444 84/150 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C234041941
eggNOG 1 0.900 E1_KOG2609
Hieranoid 1 1.000
Homologene 1 1.000 H5993
Inparanoid 1 1.050 242 1.000 Inparanoid score I3239
OMA 1 1.010
OrthoDB 1 1.010 D1565402at2759
OrthoFinder 1 1.000 FOG0005094
OrthoInspector 1 1.000 T1052942
orthoMCL 1 0.900 OOG5_130094
Panther 1 1.100 LDO PTHR13264
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1436
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.