DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12343 and SYF2

Sequence 1:NP_610617.1 Gene:CG12343 FlyBaseID:FBgn0033556 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_056299.1 Gene:SYF2 HGNCID:19824 Length:243 Species:Homo sapiens

Alignment Length:220 Identity:125/221 (57%)
Similarity:163/221 (74%) Gaps:2/221 (1%)


  Fly     7 AAEKLAERKARLLDLHKKRQEARTDNHQEVVAEDARKKLPKNWEARKRQAEWILADDKARAEAQA 71
            ||:|..:|..:..:||..|.|||..||||||.||.|.|||.||||:|.:.||.|.:::.:.|..|
Human    26 AAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAA 90

  Fly    72 AGKDYERLKLLEVSAVDADRIEKKKKRKDNPDLGFSTYEAQTARQYNRLVKSMPARDLEKYERQK 136
            .|:|||::||||:||.||:|.|:||||| |||||||.|.|...|||:||.|.:.. |:|.|||.:
Human    91 RGEDYEKVKLLEISAEDAERWERKKKRK-NPDLGFSDYAAAQLRQYHRLTKQIKP-DMETYERLR 153

  Fly   137 EELGDAFYGGAHTTLHSRTKDTPGAINKMVTDLEQQIERRKKYSRRRIYNDDADVDFINERNSKF 201
            |:.|:.|:..:::.||.....:...|::||.|||:|||:|.||||||.||||||:|:|||||:||
Human   154 EKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKF 218

  Fly   202 NKKLDRFYSEHTAEIKQNLERGTAI 226
            |||.:|||.::|||||||||||||:
Human   219 NKKAERFYGKYTAEIKQNLERGTAV 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12343NP_610617.1 SYF2 71..221 CDD:285444 89/150 (59%)
SYF2NP_056299.1 SYF2 92..238 CDD:336966 88/148 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C234041870
eggNOG 1 0.900 E1_KOG2609
Hieranoid 1 1.000
Homologene 1 1.000 H5993
Inparanoid 1 1.050 247 1.000 Inparanoid score I3216
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1565402at2759
OrthoFinder 1 1.000 FOG0005094
OrthoInspector 1 1.000 T1073635
orthoMCL 1 0.900 OOG5_130094
Panther 1 1.100 LDO PTHR13264
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1436
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.