DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpS15Ab and rps15ae

Sequence 1:NP_610616.1 Gene:RpS15Ab FlyBaseID:FBgn0033555 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_194672.1 Gene:rps15ae AraportID:AT4G29430 Length:129 Species:Arabidopsis thaliana

Alignment Length:125 Identity:62/126 (49%)
Similarity:90/126 (71%) Gaps:0/126 (0%)


  Fly     6 VLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGKIVVNLTGRLN 70
            :|.|||:.|.|||:|||..|.|:|.|.|:..||.:|.:.|||..|::.:.||.|:|.|:|.||:|
plant     5 ILNDALRTIVNAERRGKASVELKPISTVMSSFLRIMKEKGYIKNFQVYDPHRVGRITVDLQGRVN 69

  Fly    71 KCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKILGFFF 130
            .|..::.|.|....:|||:|...||:||:||||:||..||:|||||.::::||::||||:
plant    70 DCKALTYRQDVRAKEIEKYTERTLPTRQWGYVVITTPDGILDHEEAIKRNVGGQVLGFFY 129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpS15AbNP_610616.1 PTZ00158 1..130 CDD:185487 62/124 (50%)
rps15aeNP_194672.1 PLN00146 1..129 CDD:215075 62/124 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1417658at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11758
Phylome 1 0.910 0.667 Consistency score
33.020

Return to query results.
Submit another query.