DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpS15Ab and Rps15a

Sequence 1:NP_610616.1 Gene:RpS15Ab FlyBaseID:FBgn0033555 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_446434.1 Gene:Rps15a RGDID:619939 Length:130 Species:Rattus norvegicus

Alignment Length:130 Identity:114/131 (87%)
Similarity:123/131 (94%) Gaps:0/131 (0%)


  Fly     1 MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGKIVVNL 65
            ||||||||||||.|||||||||||||:|||||||::||||||||||||||||::|||||||||||
  Rat     1 MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNL 65

  Fly    66 TGRLNKCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKILGFFF 130
            |||||||||||||||..:.|:|||.||||||||||::|||||.||||||||||||.|||||||||
  Rat    66 TGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHTGGKILGFFF 130

  Fly   131  130
              Rat   131  130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpS15AbNP_610616.1 PTZ00158 1..130 CDD:185487 113/129 (88%)
Rps15aNP_446434.1 PTZ00158 1..130 CDD:185487 113/129 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C16257127
eggNOG 1 0.900 E1_COG0096
Hieranoid 1 1.000
Homologene 1 1.000 H128982
Inparanoid 1 1.050 244 1.000 Inparanoid score I3155
OMA 1 1.010
OrthoDB 1 1.010 D1417658at2759
OrthoFinder 1 1.000 FOG0002483
OrthoInspector 1 1.000 T131179
orthoMCL 1 0.900 OOG5_126878
Panther 1 1.100 O PTHR11758
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.