DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RpS15Ab and rps15a

Sequence 1:NP_610616.1 Gene:RpS15Ab FlyBaseID:FBgn0033555 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001096489.1 Gene:rps15a XenbaseID:XB-GENE-981311 Length:130 Species:Xenopus tropicalis

Alignment Length:130 Identity:115/131 (88%)
Similarity:123/131 (94%) Gaps:0/131 (0%)


  Fly     1 MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGKIVVNL 65
            ||||||||||||.|||||||||||||:|||||||::||||||||||||||||::|||||||||||
 Frog     1 MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNL 65

  Fly    66 TGRLNKCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKILGFFF 130
            |||||||||||||||..:.|:|||.|||||||||||:|||||.||||||||||||.|||||||||
 Frog    66 TGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGYIVLTTSAGIMDHEEARRKHTGGKILGFFF 130

  Fly   131  130
             Frog   131  130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RpS15AbNP_610616.1 PTZ00158 1..130 CDD:185487 114/129 (88%)
rps15aNP_001096489.1 PTZ00158 1..130 CDD:185487 114/129 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C16262695
eggNOG 1 0.900 E1_COG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H128982
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1417658at2759
OrthoFinder 1 1.000 FOG0002483
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.