DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dgo and ANKRD20A1

Sequence 1:NP_610614.1 Gene:dgo FlyBaseID:FBgn0086898 Length:927 Species:Drosophila melanogaster
Sequence 2:NP_115626.2 Gene:ANKRD20A1 HGNCID:23665 Length:823 Species:Homo sapiens

Alignment Length:849 Identity:171/850 (20%)
Similarity:286/850 (34%) Gaps:247/850 (29%)


  Fly    24 SNWTSLHEAVAAGDDRRVEGLLFSNADRLARESVQGNTPLHEAASRGFSRCVKLICTPPTPPASS 88
            |....:|.|...||...||..|...:..|.....|..|.||.|.:.|..:.|.|:..        
Human    32 SELQKIHRAAVKGDAAEVERCLARRSGDLDALDKQHRTALHLACTSGHVQVVTLLVN-------- 88

  Fly    89 GVGKAAKGQKDKDKDKNKGRVKVAHQTIEALHNSALGIANNEGLSALHLAAQNGHNQSSRELLLA 153
                 .|.|.|....:|:..:      |:|:|      ...|..:.:              ||..
Human    89 -----RKCQIDVCDKENRTPL------IQAVH------CQEEACAVI--------------LLEH 122

  Fly   154 GADPDVRNNYGDTPLHTACRYGHAGVSRILLS------ALCDPNKTNLNGDTALHITCAMGRRKL 212
            ||:|::::.||:|.||.|.......::..|||      ||...|.|.|    ...|.|.  :.|:
Human   123 GANPNLKDIYGNTALHYAVYSESTSLAEKLLSHGAHIEALDKDNNTPL----LFAIICK--KEKM 181

  Fly   213 TRILLEADA------RL--------------GIKN----------AQGDC---PMHIAIRKNYRE 244
            ...||:..|      ||              ||.|          ||..|   ....||..:..:
Human   182 VEFLLKKKASSHAVDRLRRSALMLAVYYDSPGIVNILLKQNIDVFAQDMCGRDAEDYAISHHLTK 246

  Fly   245 I-IEILNTPKKIRNRKEKPKEGGS-----------------RSDKDRDRERDVVDKGINWSPYGC 291
            | .:||...|||. :|||...|.|                 .||          ||.:|.:...|
Human   247 IQQQILEHKKKIL-KKEKSDVGSSDESAVSIFHELRVDSLPASD----------DKDLNVATKQC 300

  Fly   292 HYFPDPRAFPSPKLETLPKEPLKSGEQYFLDLAGHIHKGPVSVGNTCYCGPFFRH--IENKLNCN 354
                    .|....|.||               |..|:....:.|....||..:|  ::......
Human   301 --------VPEKVSEPLP---------------GSSHEKGNRIVNGQGEGPPAKHPSLKPSTEVE 342

  Fly   355 RKSLKKYVHKTKERLGHKVQALAIKTNDQIEQLTRTMIEDRLRCESKRQHLSEFLRRGEPMRSTF 419
            ..::|..|.:...:.....|||.:.:.:                |.:|...||   :.:|.....
Human   343 DPAVKGAVQRKNVQTLRAEQALPVASEE----------------EQERHERSE---KKQPQVKEG 388

  Fly   420 DQQNKSSRIERTMSRCRSLELLENNHEGGRLTNSRSVDVLEDQAVEAIVHRSAEVQVDSDSDDDS 484
            :..|||.:|:.:.:.|.|    .::...||||..|.:.....|....        ::..:.|..:
Human   389 NNTNKSEKIQLSENICDS----TSSAAAGRLTQQRKIGKTYPQQFPK--------KLKEEHDRCT 441

  Fly   485 NEARDEEEAEVG---DKDQVQEEAEPEEHSKLDELKLDFLKVSERLGVLLEKTTLIMERDSEQES 546
            .:..:||:..|.   .|::.:.|.:.:::.|..|.|            .||.|.    :..|.:|
Human   442 LKQENEEKTNVNMLYKKNREELERKEKQYKKEVEAK------------QLEPTV----QSLEMKS 490

  Fly   547 KRQLSSLSPPYNPHP------------RAESAQLREDKESVNSPNFDEYANVIRRYPNSSETSNP 599
            |...::.:..::.|.            :|:.|.||::..::.:.|.::....::......||:..
Human   491 KTARNTPNWDFHNHEEMKGLMDENCILKADIAILRQEICTMKNDNLEKENKYLKDIKIVKETNAA 555

  Fly   600 SQNSNSWDWEASPTGSNPHPDYNKYYQRIGRGENMLNSVIKALRKDASFADLGKEETAVN----- 659
            .:                     ||   |...|.|:...  |.|......||..|.|.:|     
Human   556 LE---------------------KY---IKLNEEMITET--AFRYQQELNDLKAENTRLNAELLK 594

  Fly   660 --ETAEGMGGDKLLYKEQASEAAGIS------NLMKRQPLCLEDNYPVMSNLFYSNPIMEYAEET 716
              |:.:.:..|...|  |:..||.||      ...:...|.||....|...:..|:.|.:...|.
Human   595 EKESKKRLEADIESY--QSRLAAAISKHSESVKTERNLKLALERTRDVSVQVEMSSAISKVKAEN 657

  Fly   717 EVRQNGNESMSKVEIRNSEIKCLKKPNAGQVRD---MVAQLQNTIDSNRQDSQTAHVIAARSHSR 778
            |..   .|.:|:.:|:.:.:|...:.....:|.   .:..:||.:...:|.:|....:...:.::
Human   658 EFL---TEQLSETQIKFNALKDKFRKTRDSLRKKSLALETVQNDLSQTQQQTQEMKEMYQNAEAK 719

  Fly   779 LNNN 782
            :||:
Human   720 VNNS 723

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dgoNP_610614.1 ANK 22..184 CDD:238125 37/160 (23%)
ANK repeat 24..55 CDD:293786 9/31 (29%)
Ank_2 29..161 CDD:289560 29/132 (22%)
ANK repeat 59..128 CDD:293786 14/69 (20%)
ANK 126..249 CDD:238125 38/163 (23%)
ANK repeat 130..161 CDD:293786 6/31 (19%)
Ank_2 135..227 CDD:289560 29/118 (25%)
ANK repeat 163..194 CDD:293786 13/37 (35%)
ANK repeat 196..227 CDD:293786 10/51 (20%)
ANKRD20A1NP_115626.2 ANK repeat 37..64 CDD:293786 8/27 (30%)
ANK 61..186 CDD:238125 39/170 (23%)
ANK 1 66..95 11/42 (26%)
ANK repeat 68..97 CDD:293786 10/42 (24%)
ANK repeat 99..130 CDD:293786 10/57 (18%)
ANK 2 99..128 10/55 (18%)
ANK 127..247 CDD:238125 30/126 (24%)
ANK repeat 132..163 CDD:293786 11/31 (35%)
ANK 3 132..161 9/29 (31%)
ANK repeat 165..196 CDD:293786 9/37 (24%)
ANK 4 165..194 9/35 (26%)
ANK repeat 198..229 CDD:293786 6/31 (19%)
ANK 5 198..227 4/29 (14%)
Mitofilin 291..690 CDD:313027 91/500 (18%)
CCDC144C 514..805 CDD:317340 46/242 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5075
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.