DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dgo and ANKRD30B

Sequence 1:NP_610614.1 Gene:dgo FlyBaseID:FBgn0086898 Length:927 Species:Drosophila melanogaster
Sequence 2:NP_001354536.1 Gene:ANKRD30B HGNCID:24165 Length:1525 Species:Homo sapiens

Alignment Length:709 Identity:142/710 (20%)
Similarity:239/710 (34%) Gaps:174/710 (25%)


  Fly    63 LHEAASRGFSRCVKLICTPPTPPASSGVGKAAKGQKDKDKDKNKGRVKVAHQTIEALHNSALGIA 127
            :|.|||||  :..||        ....|||.......:|..|.                      
Human    42 IHTAASRG--QVQKL--------EKMTVGKKPVNLNKRDMKKR---------------------- 74

  Fly   128 NNEGLSALHLAAQNGHNQSSRELLLAGADPDVRNNYGDTPLHTACRYGHAGVSRILLSALCDPNK 192
                 :|||.|..|||.:....|:......:|.:..|.|||..|.:......:.||:.|..|.|.
Human    75 -----TALHWACVNGHAEVVTFLVDRKCQLNVLDGEGRTPLMKALQCEREACANILIDAGADLNY 134

  Fly   193 TNLNGDTALHITCAMGRRKLTRILLEADARLGIKNAQGDCPMHIAIRKNYREIIEILNTPKKIRN 257
            .::.|:||||.........:...||...|.:.::|.....|:.:||:|..::.:|.|.|.....|
Human   135 VDVYGNTALHYAVYSENLLMVATLLSYGAVIEVQNKASLTPLLLAIQKRSKQTVEFLLTKNANAN 199

  Fly   258 RKEKPK---------EGGS-------RSDKDRDRERDVVDKGINWSPY----GCHYFPDPRAFPS 302
            ...:.|         ||.|       :.:.|...| |:  .||....|    |.:|......   
Human   200 AFNESKCTALMLAICEGSSEIVGMLLQQNVDVFAE-DI--HGITAERYAAACGVNYIHQQLL--- 258

  Fly   303 PKLETLPKEPLKSGEQYFLDLAGHIHKGPVSVGNTCYCGPFFRHIENKLNCNRKSLKKYVHKTKE 367
            ..:..|||.|..:..:            ..|.|......|......:......:.......:..|
Human   259 EHIRKLPKNPQNTNPE------------GTSTGTPDEAAPLAERTPDTAESLLEKTPDEAARLVE 311

  Fly   368 RLGHKVQALAIKTNDQIEQLTRTMIEDRLRCESKRQHLSEFLRRGEPMRSTFDQQ---------- 422
            ....|:|.|...|:.:.||.|.......||...:......:..:....:.|::::          
Human   312 GTSAKIQCLGKATSGKFEQSTEETPRKILRPTKETSEKFSWPAKERSRKITWEEKETSVKTECVA 376

  Fly   423 ----NKSSRIERTMSRCRSLELLENNHEGGRLTNSRSVDVLEDQAVEAI--------VHRSAEVQ 475
                ||:..:|:..|...:....|.:.:.     |.:|||   .:||.|        :..|...:
Human   377 GVTPNKTEVLEKGTSNMIACPTKETSTKA-----STNVDV---SSVEPIFSLFGTRTIENSQCTK 433

  Fly   476 VDSDSD-----------------DDSNEARDEEEAEVGDKDQV---QEEAEPEEHSKLDELKLDF 520
            |:.|.:                 .|:...:|.:......:||:   :.:.|.:|....|.     
Human   434 VEEDFNLATKIISKSAAQNYTCLPDATYQKDIKTINHKIEDQMFPSESKREEDEEYSWDS----- 493

  Fly   521 LKVSERLGVLLE---KTTLIMERDSEQ---ESKRQLSSLSPPYNPHPRAESAQLREDKESVNSPN 579
                   |.|.|   ||.:.:.....|   |..|::..|  |..|.....:.::   :::|.:..
Human   494 -------GSLFESSAKTQVCIPESMYQKVMEINREVEEL--PEKPSAFKPAVEM---QKTVPNKA 546

  Fly   580 F----DEYANVIRRYPNSSETSNPSQNSNSWDWEASP--TGSN-----PHPDYNKYYQRIGRGEN 633
            |    ::.....:.:|  ||:.......||||.| ||  |.|.     |...:.|.:..:. |:.
Human   547 FELKNEQTLRAAQMFP--SESKQKDDEENSWDSE-SPCETVSQKDVYLPKATHQKEFDTLS-GKL 607

  Fly   634 MLNSVIKALRKDASFADLGKEETAVNETAEGMGGDKLLYKEQASEAAGISNLMKRQPLC 692
            ..:.|...|.|..    .|::.:..|:..|..  |:..:|.::.:..|   |:|  |.|
Human   608 EESPVKDGLLKPT----CGRKVSLPNKALELK--DRETFKAESPDKDG---LLK--PTC 655

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dgoNP_610614.1 ANK 22..184 CDD:238125 29/121 (24%)
ANK repeat 24..55 CDD:293786
Ank_2 29..161 CDD:289560 22/98 (22%)
ANK repeat 59..128 CDD:293786 13/65 (20%)
ANK 126..249 CDD:238125 33/123 (27%)
ANK repeat 130..161 CDD:293786 9/31 (29%)
Ank_2 135..227 CDD:289560 26/92 (28%)
ANK repeat 163..194 CDD:293786 10/31 (32%)
ANK repeat 196..227 CDD:293786 8/31 (26%)
ANKRD30BNP_001354536.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5075
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.