DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dgo and Ankrd35

Sequence 1:NP_610614.1 Gene:dgo FlyBaseID:FBgn0086898 Length:927 Species:Drosophila melanogaster
Sequence 2:XP_001063190.3 Gene:Ankrd35 RGDID:1305527 Length:990 Species:Rattus norvegicus

Alignment Length:975 Identity:187/976 (19%)
Similarity:328/976 (34%) Gaps:280/976 (29%)


  Fly    29 LHEAVAAGDDRRVEGLLFSNADRLARESVQGNTPLHEAASRGFSRCVKLICTPPTPPASSGVGKA 93
            |.|||..||..||..|....:.|..:....|.:|.|.|||:|.:.|:.::       .::|....
  Rat    24 LLEAVQRGDVGRVAALASRKSARPTKLDSNGQSPFHLAASKGLTECLTIL-------LANGADIN 81

  Fly    94 AKGQKDKDKDKNKGRVKVAHQTIEAL--HNSALGIANNEGLSALHLAAQNGHNQSSRELLLAGAD 156
            :|.: |.....:...:....|.::.|  |.:.....:.|..|.||.||.:|  .:|..|||...:
  Rat    82 SKNE-DGSTALHLATISCQPQCVKVLLQHGANEDAVDAENRSPLHWAASSG--CASSVLLLCDHE 143

  Fly   157 P--DVRNNYGDTPLHTACRYGHAGVSRILLSALCDPNKTNLNGDTALHITCAMGRRKLTRILLEA 219
            .  ||.:|.|.|||..|...|||.:...||......|.|:.:..:||.:.|..|..::..:||..
  Rat   144 AFLDVLDNDGRTPLMIASLGGHAAICSQLLQRGARVNVTDKDDKSALILACEKGSAEVAELLLSH 208

  Fly   220 DARLGIKNAQGDCPMHIAIRKNYREIIEILNTPKKIRNR-----------------KEKPKEGGS 267
            .|..|..::.|...:|.|:....||:..:|......|.|                 .|.|.....
  Rat   209 GADAGAVDSLGHNALHYALGTQDRELWRLLQQALNRRRRGGRELVQHPDHASQASSSESPWRAEP 273

  Fly   268 RSDKDRDRERDVVDKGINWSPYGCHYFPDPRAFPSPKLETLPK-EPLKSGEQYFLDLAGHIHKGP 331
            ..:::.::..:...:...|.     :..:.|.....:.|.|.| :..|:....|:.|...|.:..
  Rat   274 EEEQEEEKGEERGSEEWRWK-----FEEEQRKVHQLEQELLQKTDECKARAAAFVSLENQIREQV 333

  Fly   332 VSVGNTCYC-----------GPFFRHIENKL--NCNRKSLKKYVHKTK----------------- 366
            ..:|   |.           ||..|...:.:  .|....|.:::.:.|                 
  Rat   334 QELG---YLLVQVPGAPRNQGPGLRPEGDGMEQGCPLNLLAEWIQELKKQQKATATINPTLVPKR 395

  Fly   367 -----------------------------ERLGHKVQALAIKTN-------DQIEQLTRTMIEDR 395
                                         |.:| |.....:.||       |..||:.....|..
  Rat   396 AEDLAPAETHYEVPGKFQPEQGLSQSPRSETIG-KATGQQLNTNGEQNLDLDNTEQVCADQKERA 459

  Fly   396 LRCESK---------------------RQHLSEFLRRGEPMRSTFDQ------------------ 421
            |...::                     |:.|:...|..:..|....:                  
  Rat   460 LAPGTEPAVTVGEPVGIAAMNQLLLQLREELAAVWREKDAARGALSRPVLEGALGTPRAEAAAAA 524

  Fly   422 -QNKSSRIERTMSRCRSLEL-----------------------LENNHEGGRLTNSRSVDVLEDQ 462
             :...:|:|:.:.|....::                       .....||.|...:|...:....
  Rat   525 WEKMEARLEKVLVRLDGAKMGLHVKPEVPAQGSRDGAPKIVQGCTKEQEGKRAPGARGEPLGAPG 589

  Fly   463 AVEAIVHRSAEVQVDSDSD--DDSNEARDEEEAEVG-DKDQVQEEAE-------------PEEHS 511
            ..:|:....|:.|::.:..  ..||....||..|:| ::.::|.|.:             ||...
  Rat   590 GEQALGGGLAKGQLEKEVSALRLSNSNLLEELEELGRERQRLQGELQSLTQKLQREFVPKPEAQV 654

  Fly   512 KLDELKLDFLKVSERLGVLLEKTTLIMERDSEQESKRQLSS----LSPPYNPHP---------RA 563
            :|.:|:       ..:|:|.|:  |.:|:::.::.:|:|:|    |...:|..|         |:
  Rat   655 QLQQLR-------RSVGLLTEE--LAIEKEATEKLRRRLASQTSGLQGLWNCFPPDLVGKGSARS 710

  Fly   564 ESAQLREDKESVNSPNFDEYANVIRRYPNSSETSNPSQNSNSWDWEASPTGSNPHPDYNKYYQRI 628
            .:|:..|:.::..|       .::.|:..|.:.....:..|.     ...||.|         ..
  Rat   711 TAAEPLEELQACIS-------TLVDRHLESQQVQARLEEENQ-----RLRGSLP---------PC 754

  Fly   629 GRGENMLNSV----IKALRKDASFADLGK---EETAVNETAEGMGGD-----KLLYKEQASEAAG 681
            |..|..|.:.    :.||.:     ||||   |..||..|..|...:     :|||  ||:|.  
  Rat   755 GEPEASLKATASPQVAALEE-----DLGKLEEELRAVQATMSGKSQEICKLKQLLY--QATEE-- 810

  Fly   682 ISNLMKRQPLCLEDNYPVMSNLF----------------YSNPIMEYAEETEVRQNGNESMSKVE 730
            ::.|..|:...|..:.....:|.                |:....|.   |.:|....|...:.|
  Rat   811 VAELRAREAASLRQHEKTRGSLVAQAQAWGQELKVMLEKYNTACREM---TRLRDTAAEERRRSE 872

  Fly   731 ---IRNSEIKCLKKPNAGQVRDMVAQLQNTIDSNRQDSQTAHVIAA--RSHSRLNNNFHHLEGTS 790
               .|.:|    ::..||::|....|.:.|.:..::  :|.|:|.|  ...|::......||..|
  Rat   873 ELAARAAE----QERQAGEMRGRSEQFEKTAELLKE--KTNHLIGACRDKESKIKELLKKLEQLS 931

  Fly   791  790
              Rat   932  931

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dgoNP_610614.1 ANK 22..184 CDD:238125 47/159 (30%)
ANK repeat 24..55 CDD:293786 10/26 (38%)
Ank_2 29..161 CDD:289560 37/136 (27%)
ANK repeat 59..128 CDD:293786 14/71 (20%)
ANK 126..249 CDD:238125 39/125 (31%)
ANK repeat 130..161 CDD:293786 13/33 (39%)
Ank_2 135..227 CDD:289560 32/94 (34%)
ANK repeat 163..194 CDD:293786 12/31 (39%)
ANK repeat 196..227 CDD:293786 8/31 (26%)
Ankrd35XP_001063190.3 ANK <24..107 CDD:238125 23/91 (25%)
ANK repeat 24..51 CDD:293786 10/27 (37%)
ANK repeat 53..84 CDD:293786 10/38 (26%)
Ank_2 58..150 CDD:289560 25/102 (25%)
ANK 81..206 CDD:238125 36/128 (28%)
ANK repeat 86..117 CDD:293786 4/31 (13%)
ANK repeat 119..150 CDD:293786 13/33 (39%)
Ank_2 124..216 CDD:289560 32/94 (34%)
ANK repeat 152..183 CDD:293786 12/31 (39%)
ANK repeat 185..216 CDD:293786 8/31 (26%)
Ank_2 190..>250 CDD:289560 15/60 (25%)
KASH_CCD 740..952 CDD:291334 49/225 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I4912
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.