DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dgo and ANKRD6

Sequence 1:NP_610614.1 Gene:dgo FlyBaseID:FBgn0086898 Length:927 Species:Drosophila melanogaster
Sequence 2:XP_005248736.1 Gene:ANKRD6 HGNCID:17280 Length:752 Species:Homo sapiens

Alignment Length:719 Identity:163/720 (23%)
Similarity:255/720 (35%) Gaps:237/720 (33%)


  Fly    27 TSLHEAVAAGDDRRVEGLLFSNADRLARESVQGNTPLHEAASRGFSRCVKLICTPPTPPASSGVG 91
            |:||.|...|:...:..|:.... .|.|:...|||.||||:..|||:..||:       ..:|..
Human   102 TALHRATVVGNTEIIAALIHEGC-ALDRQDKDGNTALHEASWHGFSQSAKLL-------IKAGAN 158

  Fly    92 KAAKGQKDKDKDKNKGRVKVAHQTIEALHNSALGIANNEGLSALHLAAQNGHNQSSRELLLAGAD 156
            ..||                                |..|.:|||||.||.|:||:|.|||||:.
Human   159 VLAK--------------------------------NKAGNTALHLACQNSHSQSTRVLLLAGSR 191

  Fly   157 PDVRNNYGDTPLHTACRYGHAGVSRILLSALCDPNKTNLNGDTALHITCAMGRRKLTRILLEADA 221
            .|::||.|||.||.|.||.|..:.|:||:|.|..::.|..||||||:..|:..:|:.:|||||.|
Human   192 ADLKNNAGDTCLHVAARYNHLSIIRLLLTAFCSVHEKNQAGDTALHVAAALNHKKVAKILLEAGA 256

  Fly   222 RLGIKNAQGDCPMHIAIRKNYREIIEIL---------NTPKKIRNRKEKPKEGGSRSDKDRD--- 274
            ...|.|..|..|:..|...|..|:..:|         :..:.:|.::|:.||........||   
Human   257 DTTIVNNAGQTPLETARYHNNPEVALLLTKAPQVLRFSRGRSLRKKRERLKEERRAQSVPRDEVA 321

  Fly   275 -------------------RERDVVDKGINWSPYGCHYFPDPRAFPSPKLETLPK-----EPLKS 315
                               |:.:..::.::.|       |:|||....:.::.||     :|...
Human   322 QSKGSVSAGDTPSSEQAVARKEEAREEFLSAS-------PEPRAKDDRRRKSRPKVSAFSDPTPP 379

  Fly   316 GEQ---YFLDLAGHIH-----------------------------------KGPVSVGNTCYCGP 342
            .:|   :..:|..|.|                                   :.|:   |.|.|.|
Human   380 ADQQPGHQKNLHAHNHPKKRNRHRCSSPPPPHEFRAYQLYTLYRGKDGKVMQAPI---NGCRCEP 441

  Fly   343 FFRHIENKLNCNRKSLKKYVHKTKERLGHKVQALAIKTNDQIEQLTRTMIE----DRLRCESK-R 402
            ....:||:|....:.:|..:...::::..|:..:..||..|:..|.:.|:|    :|..|.:: :
Human   442 LINKLENQLEATVEEIKAELGSVQDKMNTKLGQMENKTQHQMRVLDKLMVERLSAERTECLNRLQ 506

  Fly   403 QHLSEFLRRGEPMR-STFDQ---------QN---------KSSRIERTMSRCRS----------- 437
            ||.......||..: |..|:         ||         ::.|.:.|.|.|.|           
Human   507 QHSDTEKHEGEKRQISLVDELKTWCMLKIQNLEQKLSGDSRACRAKSTPSTCESSTGVDQLVVTA 571

  Fly   438 -----------------------------LELLENNHEGGRLTNSRSVDVL--------EDQAVE 465
                                         .||..::..|.||.|.:....|        .||...
Human   572 GPAAASDSSPPVVRPKEKALNSTATQRLQQELSSSDCTGSRLRNVKVQTALLPMNEAARSDQQAG 636

  Fly   466 AIVHRSAEVQVDSDSDDDSNEAR-----------------DEEEAEVGDKDQVQE------EAEP 507
            ..|:|..:.:....|....:.|:                 ::....:.|..|..|      ||..
Human   637 PCVNRGTQTKKSGKSGPTRHRAQQPAASSTCGQPPPATGSEQTGPHIRDTSQALELTQYFFEAVS 701

  Fly   508 EEHSKLDELKLDFLKVSERLGVLLEKTTLIMERDSEQESKRQLSSLSPPYNPHPRAESAQLREDK 572
            .:..|..|.|::..:.........:|.||          |..:.||        ..|.|:||...
Human   702 TQMEKWYERKIEEARSQANQKAQQDKATL----------KEHIKSL--------EEELAKLRTRV 748

  Fly   573 ESVN 576
            :..|
Human   749 QKEN 752

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dgoNP_610614.1 ANK 22..184 CDD:238125 55/157 (35%)
ANK repeat 24..55 CDD:293786 8/28 (29%)
Ank_2 29..161 CDD:289560 41/132 (31%)
ANK repeat 59..128 CDD:293786 15/69 (22%)
ANK 126..249 CDD:238125 57/123 (46%)
ANK repeat 130..161 CDD:293786 18/31 (58%)
Ank_2 135..227 CDD:289560 48/92 (52%)
ANK repeat 163..194 CDD:293786 14/31 (45%)
ANK repeat 196..227 CDD:293786 15/31 (48%)
ANKRD6XP_005248736.1 ANK repeat 101..130 CDD:293786 8/29 (28%)
Ank_2 104..196 CDD:289560 41/132 (31%)
ANK 127..252 CDD:238125 62/164 (38%)
ANK repeat 132..163 CDD:293786 15/70 (21%)
ANK repeat 166..196 CDD:293786 18/30 (60%)
Ank_2 170..262 CDD:289560 48/92 (52%)
ANK repeat 198..229 CDD:293786 14/31 (45%)
ANK repeat 231..262 CDD:293786 15/31 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C319630090
eggNOG 1 0.900 E33208_3BHC7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005594
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24203
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R10493
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.