DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nop10 and nop10

DIOPT Version :10

Sequence 1:NP_610610.1 Gene:Nop10 / 36135 FlyBaseID:FBgn0033548 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_001003868.1 Gene:nop10 / 445391 ZFINID:ZDB-GENE-041007-4 Length:64 Species:Danio rerio


Alignment Length:63 Identity:44/63 - (69%)
Similarity:54/63 - (85%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKKRFGLLLTQKPEPI 63
            |:|.:.:||||:|||||||....|:||.|||||||||:||:||.|:||||||||||||:|.|:
Zfish     1 MFLQFYLNENGERVYTLKKVDPSGQPTSSAHPARFSPDDKFSRHRVTIKKRFGLLLTQQPRPV 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nop10NP_610610.1 Nop10p 4..52 CDD:427735 32/47 (68%)
nop10NP_001003868.1 Nop10p 4..52 CDD:427735 32/47 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..40 13/20 (65%)

Return to query results.
Submit another query.