DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11883 and NT5E-2

Sequence 1:NP_001097260.1 Gene:CG11883 FlyBaseID:FBgn0033538 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_611218.1 Gene:NT5E-2 FlyBaseID:FBgn0050104 Length:585 Species:Drosophila melanogaster

Alignment Length:561 Identity:124/562 (22%)
Similarity:229/562 (41%) Gaps:113/562 (20%)


  Fly   151 LLTRPTRAYASVSQPQSPRHRGSGCGSVSGSRIITHGLTGRSTSISSQLEKTKKLLKMTEGEDKP 215
            :|...|||...:|.|:           |:...||.|     :..:.::.::|    .:..|...|
  Fly    13 VLAHWTRANPILSHPK-----------VATEFIILH-----NNDMHARFDQT----SVNSGTCPP 57

  Fly   216 LTILHYNDVYNIESMAETEPVGGAARFATAIKSF------AHLNPLVLFSGDAFSPSMLSTFTQG 274
            ..: |.|..|           ||.||.|..::.:      ...:.|.|.:||.::.:...|..:.
  Fly    58 EDV-HTNKCY-----------GGFARVAHEVRKYRKEAQEGGTSVLYLNAGDTYTGTSWFTIFKD 110

  Fly   275 EQMIPVLNTVGTHCAVFGNHDFDHGLDVLVKLIKQTEFP-----------------WLMSNVVDN 322
            :.....||.:.......|||:||..::.|:..:.:..||                 |.::|....
  Fly   111 KIASAFLNKLKPDAISLGNHEFDERVEGLIPFLNEVTFPVLACNLDLSKVPQLKATWHLANSAIL 175

  Fly   323 ETGRPLGGGKISHFILHNQISIGLIGLVEREWLETLPTIDPNEVTYIDYVEAGNKLARELRNEGC 387
            ||               |...:|:||.:..:..:....:|   |.:.:.||:.|..|::|:.:|.
  Fly   176 ET---------------NGTKVGVIGYLTPDTKKLTLNMD---VEFNEEVESINVEAKKLKAQGI 222

  Fly   388 DLIIALTHMRTPNDINLAEKCNGIDIILGGH-------------DHV-----REVTEINGK--MI 432
            .:||||.|.....|:.:|:.|..:||::|||             :|:     ..|.:.:||  .:
  Fly   223 KIIIALGHSGYLKDLEIAKNCPEVDIVIGGHTNTFLYTGAQPDAEHIDGPYPTMVKQNSGKEVPV 287

  Fly   433 VKSGTDFQQFSVITIERDAANREHFTTDVKCFDVTAKIPEDPELKQELSKYAKFIESKLSDVMGV 497
            |::....:....:.::.| |:......|.....:.|.:.::.:|...|..:...:......|:|.
  Fly   288 VQAYAYTKYLGKLHVQFD-ADGNLIQWDGSPILLNASVAQEQDLLDLLEVFRPNVTRLEKSVVGH 351

  Fly   498 FSVELDGRFSRVRTQETNLGNWVCDVVLAA-----------VGADVVILNGGTFRSD-RVHPVGA 550
            ..|.|:|..:..|.:|.||||.:.|.::.:           ..|.:.|:.||..||. .....||
  Fly   352 TKVHLEGNKAVCRAEECNLGNLIADAMVFSRLMEEQGGDFWTDAAISIMQGGGIRSSIEKRSDGA 416

  Fly   551 FTMGDLVNVIPMRDPLILLEVKGKILWQALENGVSAYPK-LEGRFPQVSGISFAFDPQAEPGKRI 614
            .|..|:::|:|..:.|.::.:.|..:.:|||:|.:...| .:|.|.|||||...|:.....|:|:
  Fly   417 ITDNDILSVLPWGNKLYMVPMTGSTIRRALEHGAALRGKDSDGGFLQVSGIRVVFNSNKPEGQRV 481

  Fly   615 DPQLIQVG----DEYLNLEQS--YKLCVKSYIFMGCDGYTM 649
            ....::..    ..|.:|..:  |.:.:..::..|.||:.|
  Fly   482 VSVQVRCAACRVPTYSDLNDTAIYNVVLGEFLLDGGDGHVM 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11883NP_001097260.1 UshA 202..661 CDD:223808 114/511 (22%)
MPP_CG11883_N 216..473 CDD:277351 61/300 (20%)
5_nucleotid_C 494..646 CDD:280945 46/171 (27%)
NT5E-2NP_611218.1 MPP_CD73_N 33..320 CDD:277354 66/327 (20%)
nadN 35..520 CDD:211667 115/525 (22%)
5_nucleotid_C 348..519 CDD:280945 46/171 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280679985
eggNOG 1 0.900 E1_COG0737
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127246
Panther 1 1.100 P PTHR11575
RoundUp 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.