DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12896 and Prdx6

DIOPT Version :8

Sequence 1:NP_610584.2 Gene:CG12896 / 36101 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_446028.1 Gene:Prdx6 / 94167 RGDID:71005 Length:224 Species:Rattus norvegicus

Alignment Length:216 Identity:115/217 (53%)
Similarity:147/217 (68%) Gaps:2/217 (1%)


  Fly     3 LGQTVPNFEADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTKCLAH 67
            ||...|||||:||.|.|:||::.|:||.:|||||.||||||||||||.|...|||||||.|.:|.
  Rat     7 LGDEAPNFEANTTIGHIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIAL 71

  Fly    68 SVDALNSHVDWVNDIKSYCLDIPGD-FPYPIIADPTRDLAVTLGMLDEEQKKDPEVGKTIRALFI 131
            |:|::..|..|..||.:|....|.: .|:|||.|..||||:.|||||..:|.:..:..|.|.:||
  Rat    72 SIDSVEDHFAWSKDINAYNGAAPTEKLPFPIIDDKDRDLAILLGMLDPAEKDEKGMPVTARVVFI 136

  Fly   132 ISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILPSVTDDEAHK 196
            ..||.|::||:.||.:||||.|||||.:|||||| ....||||.:|..|..||:||::.::||.:
  Rat   137 FGPDKKLKLSILYPATTGRNFDEILRVVDSLQLT-ASNPVATPVDWKKGESVMVLPTLPEEEAKQ 200

  Fly   197 LFPKGFDKVSMPSGVNYVRTT 217
            |||||.....:|||..|:|.|
  Rat   201 LFPKGVFTKELPSGKKYLRYT 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12896NP_610584.2 AhpC 1..194 CDD:223527 103/192 (54%)
PRX_1cys 3..218 CDD:239314 115/217 (53%)
Prdx6NP_446028.1 AhpC 5..200 CDD:223527 104/194 (54%)
PRX_1cys 7..222 CDD:239314 115/217 (53%)
Required and sufficient for targeting to lysosomes and lamellar bodies. {ECO:0000269|PubMed:19700648} 31..40 6/9 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61056022
eggNOG 1 0.900 E1_COG0450
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1129256at2759
OrthoFinder 1 1.000 FOG0002079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126593
Panther 1 1.100 O PTHR43503
Phylome 1 0.910 0.647 Consistency score
TreeFam 1 0.960
98.710

Return to query results.
Submit another query.