DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12896 and Jafrac2

Sequence 1:NP_610584.2 Gene:CG12896 FlyBaseID:FBgn0033521 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001261350.1 Gene:Jafrac2 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster

Alignment Length:208 Identity:64/209 (31%)
Similarity:95/209 (45%) Gaps:29/209 (14%)


  Fly     3 LGQTVPNFE--ADTTKGPIK--FHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKRNTK 63
            :.:..|.||  |...|..:|  ..::.| .:|||..:|.|||.||.||:...:....||.|..|:
  Fly    52 ISKPAPQFEGTAVVNKEIVKLSLSQYLG-KYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKTE 115

  Fly    64 CLAHSVDALNSHVDWVNDIKSYCLDIP------GDFPYPIIADPTRDLAVTLGMLDEEQKKDPEV 122
            .:..|||:..:|:.|:|        .|      ||...|:::|.|..::...|:..|..      
  Fly   116 VIGVSVDSHFTHLAWIN--------TPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESS------ 166

  Fly   123 GKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPGTKVMILP 187
            |..:|.||||.....:|......:..||:|||.:|.:.:.|.||....|. ||.|.||... |:|
  Fly   167 GHALRGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVC-PAGWRPGADT-IVP 229

  Fly   188 SVTDDEAHKLFPK 200
            :  .:|..|.|.|
  Fly   230 N--PEEKTKYFAK 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12896NP_610584.2 AhpC 1..194 CDD:223527 61/201 (30%)
PRX_1cys 3..218 CDD:239314 64/209 (31%)
Jafrac2NP_001261350.1 AhpC 51..241 CDD:223527 64/209 (31%)
PRX_Typ2cys 52..223 CDD:239313 57/187 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C61062988
eggNOG 1 0.900 E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126593
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.730

Return to query results.
Submit another query.