powered by:
Protein Alignment CG11825 and higd2a
DIOPT Version :9
Sequence 1: | NP_001260865.1 |
Gene: | CG11825 / 36099 |
FlyBaseID: | FBgn0033519 |
Length: | 136 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001017641.1 |
Gene: | higd2a / 550334 |
ZFINID: | ZDB-GENE-050417-119 |
Length: | 116 |
Species: | Danio rerio |
Alignment Length: | 70 |
Identity: | 26/70 - (37%) |
Similarity: | 38/70 - (54%) |
Gaps: | 5/70 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 NKLSRKVKESPFMLVGIAGFVAAGL--IGAYKYRNRGSMSTSVFLMQLRVAAQGTVVGCLTAGLA 115
:|..||.||:||:.:|..|...|.: :||:| :|....|..||:.|:.|||..|..:..|:|
Zfish 47 DKFIRKTKENPFVPIGCLGTAGALIYGLGAFK---QGKTRQSQLLMRTRIFAQGFTVVAIIVGVA 108
Fly 116 YTMAK 120
.|..|
Zfish 109 ATALK 113
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4431 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000673 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.