DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11825 and higd2a

DIOPT Version :10

Sequence 1:NP_001260865.1 Gene:CG11825 / 36099 FlyBaseID:FBgn0033519 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001017641.1 Gene:higd2a / 550334 ZFINID:ZDB-GENE-050417-119 Length:116 Species:Danio rerio


Alignment Length:70 Identity:26/70 - (37%)
Similarity:38/70 - (54%) Gaps:5/70 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NKLSRKVKESPFMLVGIAGFVAAGL--IGAYKYRNRGSMSTSVFLMQLRVAAQGTVVGCLTAGLA 115
            :|..||.||:||:.:|..|...|.:  :||:|   :|....|..||:.|:.|||..|..:..|:|
Zfish    47 DKFIRKTKENPFVPIGCLGTAGALIYGLGAFK---QGKTRQSQLLMRTRIFAQGFTVVAIIVGVA 108

  Fly   116 YTMAK 120
            .|..|
Zfish   109 ATALK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11825NP_001260865.1 HIG_1_N 61..113 CDD:461361 18/53 (34%)
higd2aNP_001017641.1 HIG_1_N 55..106 CDD:461361 18/53 (34%)

Return to query results.
Submit another query.