DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11825 and higd2a

DIOPT Version :9

Sequence 1:NP_001260865.1 Gene:CG11825 / 36099 FlyBaseID:FBgn0033519 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001017641.1 Gene:higd2a / 550334 ZFINID:ZDB-GENE-050417-119 Length:116 Species:Danio rerio


Alignment Length:70 Identity:26/70 - (37%)
Similarity:38/70 - (54%) Gaps:5/70 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NKLSRKVKESPFMLVGIAGFVAAGL--IGAYKYRNRGSMSTSVFLMQLRVAAQGTVVGCLTAGLA 115
            :|..||.||:||:.:|..|...|.:  :||:|   :|....|..||:.|:.|||..|..:..|:|
Zfish    47 DKFIRKTKENPFVPIGCLGTAGALIYGLGAFK---QGKTRQSQLLMRTRIFAQGFTVVAIIVGVA 108

  Fly   116 YTMAK 120
            .|..|
Zfish   109 ATALK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11825NP_001260865.1 HIG_1_N 63..111 CDD:282450 17/49 (35%)
higd2aNP_001017641.1 HIG_1_N 57..104 CDD:282450 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4431
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000673
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.