DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12898 and CG13250

Sequence 1:NP_610581.1 Gene:CG12898 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster

Alignment Length:153 Identity:31/154 (20%)
Similarity:63/154 (41%) Gaps:29/154 (19%)


  Fly     9 EFILESLETNC---DHDYVEYFR----KVP-------NTKLLYTFRVVKLAPAFTIDITV----- 54
            :|.:...:.||   |....|.|:    ::|       ||.||....|.|:    .::::|     
  Fly    30 DFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRSVTKM----WVELSVGQIAN 90

  Fly    55 -KVVKTQRIFYKMENIKGCDFLNNPLLFKMFGEVYNHLVVNGSY-FKCPIKPKVYYLKNEGTVS- 116
             |....|::| |: .:.||..:......::...|.:.|:.:|:| ..||:...|.|......:: 
  Fly    91 RKDRPVQQLF-KI-RVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDACPLLANVNYTSTRFALNP 153

  Fly   117 -IIPSIHPPGRFQLSMRVRMAES 138
             ..|:..|..:|...:..:::.:
  Fly   154 DHFPAYMPDMKFNTKLVFQLSRN 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 48..129 CDD:284008 18/90 (20%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 16/85 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.