DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12898 and CG13589

DIOPT Version :9

Sequence 1:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:86 Identity:20/86 - (23%)
Similarity:32/86 - (37%) Gaps:11/86 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VEYFR--KVPNTKLLYTFRVVKLAPAFTIDITVKVVKT---QRIFYKMENIKGCDFL---NNPLL 80
            |.|.|  ....||.........:.||..|.:.:|::|.   .:.|........|:|:   |.|..
  Fly    42 VHYCRLKAYSRTKTSLNINATFIEPAKNIYLHMKMMKKANGYKPFLFDYTFDACEFMRRRNQPFA 106

  Fly    81 FKMFGEVYNHLVVNGSYFKCP 101
            ..::..:.|...||.:   ||
  Fly   107 KIVWNMIKNVSTVNHT---CP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 48..129 CDD:284008 13/60 (22%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 10/45 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.