DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12898 and CG33795

DIOPT Version :10

Sequence 1:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:123 Identity:26/123 - (21%)
Similarity:46/123 - (37%) Gaps:35/123 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RKVPNTKLLYTFRVVKLAPAFTIDITVKVVKTQRIF----YKMENIKGCDFLNNP---------L 79
            :.|...:.::.|......|...:.|..:.:|.:..:    || :||.||.||..|         :
  Fly    49 KAVNRNRTVFNFNATIHHPTNDVVIDYRFLKRENGYKPWLYK-KNIDGCRFLRKPYDMLTKMIYM 112

  Fly    80 LFKMFGEV------YNHLVVNGSYFKCPIKPKVYYLKNEGTVSIIPSIHPPGRFQLSM 131
            :||.|..:      |..:::.|.|.:..||...|               |.|::.|.:
  Fly   113 VFKPFSNINHTCPFYGDILIRGMYLRTEIKAMPY---------------PSGKYMLQI 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 58..129 CDD:461928 21/89 (24%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 21/91 (23%)

Return to query results.
Submit another query.