DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12898 and CG33644

Sequence 1:NP_610581.1 Gene:CG12898 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001027259.1 Gene:CG33644 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster

Alignment Length:154 Identity:35/155 (23%)
Similarity:63/155 (41%) Gaps:33/155 (21%)


  Fly    22 DYVEYF-----RKVPNTKLLYTFRVVKLAPAFTIDITVKVVKTQRIF----------YKMENIKG 71
            :||:.|     :|.||:      .....:..|::...|..|:...:|          |....|..
  Fly    16 EYVQNFSCRLHKKSPNS------GSKSFSAEFSLRKEVNDVRGAYVFSFKQGKSIINYTAMEIDY 74

  Fly    72 CDFLN---NPLLFKMFGEVYNHLVVNGSYFKCP-IKPKVYYLKNEGTVS--IIPSIHPPGRFQLS 130
            |..|:   :.:|||:..:....  |:.....|| :..|.||: :|.|::  :|||..|...|...
  Fly    75 CQALSALQSQILFKLIADELRR--VSNFPLNCPFVMNKRYYV-DEFTINPKVIPSYTPEMIFTSD 136

  Fly   131 MRVRMAESRAPFVMEMLWKYKIVR 154
            ..:.:.:.||   |::....::||
  Fly   137 CNIFIKKRRA---MQLTIHGRVVR 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 48..129 CDD:284008 24/97 (25%)
CG33644NP_001027259.1 DUF1091 50..133 CDD:284008 21/86 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.