DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12898 and dls

DIOPT Version :10

Sequence 1:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001368948.1 Gene:dls / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster


Alignment Length:122 Identity:29/122 - (23%)
Similarity:50/122 - (40%) Gaps:33/122 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NIEFILESLET------NCDHDYVEYFRK---VP--NTKLLYTFRVVKLA-PAFTIDIT---VKV 56
            |::|:  |..|      |..|.|:..:.|   ||  :.::...||..... ..|..|::   .|.
  Fly    32 NLDFM--SFPTCRIKAVNRTHKYISIYAKLNQVPIVDARVTIQFRRFDSGYKPFLYDLSYDGCKF 94

  Fly    57 VKTQ---------RIFYKMENIK-GCDFLNNPLLFKMF----GEVYNHLVV--NGSY 97
            :|||         |.|.:..||. .|.:.::.::.|:|    .|.:...::  ||.|
  Fly    95 MKTQKNVLVKTFYRTFQRNTNINHTCPYDHDLIVDKLFTGNLEEEFGRFIIIPNGDY 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 58..129 CDD:461928 14/56 (25%)
dlsNP_001368948.1 DUF1091 73..153 CDD:461928 19/79 (24%)

Return to query results.
Submit another query.