DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12898 and CG33630

DIOPT Version :10

Sequence 1:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster


Alignment Length:102 Identity:25/102 - (24%)
Similarity:44/102 - (43%) Gaps:21/102 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YKMENIKGCDFLN----NPLLFKMFGE--VYNHLVVNGSYFKCPIKPKVYYLKNEGTVSIIPSIH 122
            :::..|..|:||:    ||::..||.:  ..|.::|      ||::...|.|.|.   .|..:||
  Fly   100 FELRRINFCEFLSEYNTNPMMEMMFKKNVKLNDIIV------CPVRVGNYSLLNS---DIAENIH 155

  Fly   123 PPG------RFQLSMRVRMAESRAPFVMEMLWKYKIV 153
            ..|      ||...:...:.|....|.:::..:..||
  Fly   156 ADGVQNGTYRFFAEIVEEIGEIAKVFALQVTSEVYIV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 58..129 CDD:461928 21/76 (28%)
CG33630NP_001027166.1 DM8 96..186 CDD:214778 23/94 (24%)

Return to query results.
Submit another query.