powered by:
Protein Alignment: CG12898 and CG33771
Sequence 1: | NP_610581.1 |
Gene: | CG12898 |
FlyBaseID: | FBgn0033516 |
Length: | 156 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027145.3 |
Gene: | CG33771 |
FlyBaseID: | FBgn0053771 |
Length: | 178 |
Species: | Drosophila melanogaster |
Alignment Length: | 64 |
Identity: | 12/65 (18%) |
Similarity: | 29/65 (45%) |
Gaps: | 7/65 (11%) |
Fly 50 IDITVKVVKT---QRIFYKMENIKGCDFLNNPLLFKMFGEVYNHLVVNGSY-FKCPIKPKVYYL 109
:||.:::... |.:|.:..::..........|||.: :..:..|.:: :.||::...||:
Fly 69 VDILLRLANAKNFQSMFSQKSDVCAVTSSVKNSLFKSW---FKDMSKNSNFMYNCPVEVGHYYM 129
|
Known Domains:
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12898 | NP_610581.1 |
DUF1091 |
48..129 |
CDD:284008 |
12/65 (18%) |
CG33771 | NP_001027145.3 |
DM8 |
80..171 |
CDD:214778 |
10/54 (19%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
|
|
P |
PTHR20898 |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.