DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12898 and CG33770

DIOPT Version :10

Sequence 1:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster


Alignment Length:137 Identity:31/137 - (22%)
Similarity:65/137 - (47%) Gaps:20/137 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KGNIEFILESLETNCDHDYVEYFR-KVPNTKL---LYTFRVVKLAPAFTIDITVKVVKT---QRI 62
            :|:::||  :.|:..:..|.|.|. .:.|.|:   :|..:.:.......:|...:|..:   |.:
  Fly    29 EGSVKFI--AGESRFNRKYFENFTFTIRNDKIFLDMYLRKPLVRGWRARLDFRTRVGNSKSFQSL 91

  Fly    63 FYKMENIKGCDFLNNPLLFKMFGEVYNHLVVNGSYFK-CPIKPKVYYLKN----EGTVSIIPSIH 122
            |  ..:|..|:.:|...: .:|.:.|.:|:..|::.: ||:....|||::    ||   ::|...
  Fly    92 F--STSIDVCNIVNAAKI-NLFKKWYKNLLKYGNFLRQCPLNASHYYLRDWQFGEG---LVPPFI 150

  Fly   123 PPGRFQL 129
            ..|.::|
  Fly   151 TSGSYRL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 58..129 CDD:461928 18/78 (23%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 19/76 (25%)

Return to query results.
Submit another query.